PD50AE - Hi-fi system PIONEER - Free user manual and instructions

Find the device manual for free PD50AE PIONEER in PDF.

📄 144 pages PDF ⬇️ English EN 💬 AI Question 🖨️ Print
Notice PIONEER PD50AE - page 3
Manual assistant
Powered by ChatGPT
Waiting for your message
Product information

Brand : PIONEER

Model : PD50AE

Category : Hi-fi system

Download the instructions for your Hi-fi system in PDF format for free! Find your manual PD50AE - PIONEER and take your electronic device back in hand. On this page are published all the documents necessary for the use of your device. PD50AE by PIONEER.

USER MANUAL PD50AE PIONEER

CLASS 1 LASER PRODUCT

What's in the box 1. Main unit (1)2. Remote controller (RC-980C) (1), Batteries (AAA/R03) (2)3. Analog Audio Cable (For testing operation) (1)4. Power Cord (1)• Instruction Manual (This document) (1)• The power cord must be connected only after all other cable connections are completed.• We will not accept responsibility for damage arising from the connection of equipment manufactured by other companies.• Specifications and appearance are subject to change without prior notice. The main power cannot be turned on or off with the remote controller. Use the 8 STANDBY/ ON button on the main unit.

> Before Start >Part Names > Install > Playback Advanced Setup | Others Front Panel Part Names

1. 8 STANDBY/ON button/indicator: Switch the main power of the unit on and off. When

starting up the unit, the indicator in the center of the button lights blue.

2. STANDBY indicator: Lights red when the unit is in standby mode.

3. Disc tray: Place discs here. 8-cm discs can also be used.

u t : Return to the beginning of the track being played. Press again to move to the track before. Press and hold to rewind the track quickly.

/h : Play or pause play. y i : When pressed during play, move to the next track. Press and hold to fast- forward through the track.

  • The reception range of the remote controller is within a distance of approx. 16´/5 m, and an angle of 20° in vertical direction and 30° to right and left.

7. CD/SACD button/indicator: Switch between CD/SACD as the source. When playing a

hybrid SACD, the layer being played switches if you press this during play. (P18) The indicator lights blue when SACD is selected.

8. DIRECT button/indicator: Switch the DIRECT mode ON and OFF. (P15)

SOURCE button: Switches the source to be played.

1. ANALOG OUT jack: Use an analog audio cable to connect an integrated amplifier, for

example.2. AC IN: Connect the supplied power cord.

3. USB DAC port: Use a USB cable (A-B type) to connect a computer.

4. DIGITAL OUT OPTICAL/COAXIAL jack: Use a digital optical cable or digital coaxial cable

to connect an integrated amplifier, for example.

5. CONTROL IN/OUT jack: By connecting Pioneer brand amplifiers and audio devices,

centralized control is possible, for example you can control the amplifiers and audio devices.

is on, this turns the unit on or into standby mode. The main power cannot be turned on or off with the remote controller.

of a music CD when selecting tracks. Also used to enter track numbers for program play.

5. CLEAR button: Clear the content set for program play.

6. DIGITAL FILTER button: Select one of three types of

and press ENTER to confirm.

u : Return to the beginning of the track being played. Press again to move to the track before. /h : Play or pause play. i : Move to the next track. t : Press and hold to fast-rewind through the track being played. g : Stop playback. y : Press and hold to fast-forward through the track being played.

SOURCE button: Switches the source to be played.

DIRECT button: Switch the DIRECT mode on and off. (P15)

  • Depending on the source, the operation may not start.

; OPEN/CLOSE button: Open or close the disc tray.

UP SAMPLING button: Switch the UP SAMPLING feature ON and OFF. (P15)

CD/SACD button: Switch between CD/SACD as the source. When playing a hybrid SACD, the layer being played switches if you press this during play. (P18)

DISPLAY OFF button: Press to turn off the display of this unit. Press again to turn the display on.

DIMMER button: You can adjust the brightness of the display in three steps. (Default Value: Level 3)

Display 1. Lights during play of SACD and DSD.2. Message display: Displays information about tracks and menus.3. Lights when operations with the cursor buttons on the remote controller are possible.4. Displays the play status.

5. Lights when the digital audio output setting is on. (P16)

6. Lights when showing such items as the remaining time for a track or the disc, or the total

7. Display when an MQA file or stream is played. For details, refer to "Playing MQA".

Connections with an amplifier Install

Play the audio from discs played on this unit and from devices connected to this unit through speaker systems connected to integrated amplifiers or AV receivers. Connect to suit the input jacks on your amplifier.Connecting with an analog audio cableThe signal is converted to analog in the D/A converter of this unit and then output to an integrated amplifier, for example. Connect the LINE IN jacks on an integrated amplifier to the ANALOG OUT jack (RCA jack) on this unit.

This unitIntegrated amplifier, AV receiver, etc. a Analog Audio Cable9 > Before Start > Part Names >Install > Playback Advanced Setup | Others

Connecting with a digital optical cable The signal is converted to analog in the D/A converter of the integrated amplifier, for example. Connect the OPTICAL IN jack on an integrated amplifier to the DIGITAL OUT OPTICAL jack on this unit.

  • The audio of SACD and DSD or input from USB DAC is not output from the DIGITAL OUT OPTICAL jack of this unit.
  • The digital signals that can be output by this unit are linear PCM signals with a sampling frequency and quantization bit rate of 192 kHz/24 bit (operation may not be possible with all connected devices or environments). Connecting with a digital coaxial cable The signal is converted to analog in the D/A converter of the integrated amplifier, for example. Connect the COAXIAL IN jack on an integrated amplifier to the DIGITAL OUT COAXIAL jack on this unit.
  • The audio of SACD and DSD or input from USB DAC is not output from the DIGITAL OUT COAXIAL jack of this unit.
  • The digital signals that can be output by this unit are linear PCM signals with a sampling frequency and quantization bit rate of 192 kHz/24 bit (operation may not be possible with all connected devices or environments).10 > Before Start > Part Names >Install > Playback Advanced Setup | Others The control jack If you have multiple Pioneer brand devices, and if they have CONTROL IN/OUT jacks, you can centrally control them through the remote controller sensor on the amplifier, for example. By connecting with monaural miniplug cables (without resistors) as shown in the diagram, then even if this unit and other devices are put in locations where they cannot receive the remote controller signal, you can still use the remote controller to control this unit or other devices by pointing the remote controller at the remote controller sensor on the amplifier, for example.
  • Also make sure to connect with the analog audio cable. Centralized control cannot work correctly with only the control jack connection.
  • The remote controller sensor on this unit stops working if you connect a monaural miniplug cable (without resistor) to the CONTROL IN jack of this unit.
  • The remote controller sensors on the other devices stop working if you connect a monaural miniplug cable (without resistor) to the CONTROL OUT jack of this unit.
  • If a Pioneer brand network player and amplifier is connected by the CONTROL IN/OUT jack, you can perform basic operations on this unit, the network player, and amplifier on a smart phone app over a network. (One example of connection)

Connecting the power cord, etc.

Power cord connectionThis model includes a removable power cord.The power cord must be connected only after all other connections are completed. Make sure you first connect the power cord to AC IN terminal of the unit and then connect to the outlet. Always disconnect the outlet side first when disconnecting the power cord.Starting upPress 8 STANDBY/ON on the main unit.• When starting up, press until the button goes in. When starting up the unit, the 8 STANDBY/ON indicator in the center of the button lights blue.a Power Cord12 > Before Start > Part Names > Install > Playback Advanced Setup | Others Playing discs PlaybackRefer to (P18) for discs you can play on this unit. Playing music CDs Perform the following procedure when the unit is on.1. Press CD/SACD on the remote controller to set the source to CD/SACD.

2. Press ; on the main unit to open the disc tray, and after

putting the disc on the tray, press ; again to close the tray.

3. Press /h (g) on the remote controller to start play.

4. Use play buttons (h) to stop play or choose tracks to play. You can also select by entering the track number with number buttons (b). When entering a 2-digit track number, press the +10 button as many times as the value of the second (tens) digit, then press the value of the first digit. If you press DISPLAY (d), you can switch the display to show the elapsed time or remaining time of the disc, etc.• The content displayed depends on the disc. Playing a disc with music files Perform the following procedure when the unit is on.1. Press CD/SACD on the remote controller to set the source to CD/SACD.

2. Press ; on the main unit to open the disc tray, and after

putting the disc on the tray, press ; again to close the tray.

3. Press /h (g) on the remote controller to start play.

4. Use play buttons (h) to stop play or choose tracks to play. If you press DISPLAY (d), you can switch the display to show the elapsed time or remaining time of the disc, the file name of the track, or the track name, etc.• The content displayed depends on the disc and file.• Track name display is supported with MP3/WMA/FLAC/AAC (M4A only)/DSD (DSF only) format music files only.• Characters that cannot be displayed by this unit appear as "".

1. Repeatedly press REPEAT (a) during play to display

or on the display. : Repeat play of all tracks. : Repeat play of the being played track. To cancel repeat play, press REPEAT (a) several times to display on the display. Shuffle play

1. Press SHUFFLE (f) during play or stop to display on

the display. : Play all tracks randomly. To cancel shuffle play, press SHUFFLE (f) to display on the display. Program play You can select the order to play tracks on a music CD.

1. Press PROGRAM (e) while stopped.

"P00" is displayed when nothing has been registered. Enter the track number you want to register with the number buttons (b). When entering a 2-digit track number, press the +10 button as many times as the value of the second (tens) digit, then press the value of the first digit. The number in "P00" increases each time you register a track. Up to 24 tracks can be registered.

  • To play the registered program, press /h (g) on the remote controller.
  • If you press CLEAR (c) while registering tracks, the tracks are cleared in order, starting from the one you registered last.
  • If you press PROGRAM (e) while registering tracks, all the tracks you registered are cleared.
  • If the total play time of the registered program exceeds 99 minutes 59 seconds, " : " is displayed on the display. ALL

OFF OFF Specifications of files that can be played

  • When playing files exceeding 48 kHz, use files that have been recorded on a DVD disc. Notes regarding all types of files
  • Use CD/CD-R/CD-RW discs that conform to the ISO9660 level 1/level 2 CD-ROM file system standard and that are recorded using the system conforming to extended formatting (Joliet and Romeo). When using DVD discs, then along with the above, use discs recorded using the UDF file system.
  • Folder structure is limited to eight levels and the maximum number of tracks is 3000. However, depending on the folder structure, not all folders and tracks may be recognized and played. Notes regarding specific types of files
  • Encode WMA files using applications certified by the Microsoft Corporation of the United States. Operation may not be correct if you use uncertified applications.
  • This unit supports play of AAC files with the extension ".m4a" that have been encoded using iTunes. However, play not be possible if the file has been protected with DRM copy protect (copyright protection) or with some versions of iTunes used for encoding.
  • WAV files include uncompressed PCM digital audio.
  • AIFF files include uncompressed PCM digital audio. Sampling rates Bitrates Quantization bit Types of discs that can be played Extension CD-R/ CD-RW DVD-R/ DVD-RW DVD+R/ DVD+RW MP3 44.1/48 kHz Between 8 kbps and 320 kbps and VBR. –.mp3 WMA 44.1/48 kHz Between 5 kbps and 192 kbps and VBR. –.wma AAC 44.1/48/88.2/96 kHz Between 8 kbps and 320 kbps and VBR.

Using this unit as a D/A converter

You can convert the digital audio of the PC to analog on this unit, and then output it from the ANALOG OUT jacks. Switching the source

1. Press SOURCE of this unit or the remote controller to switch the source of the unit to "USB DAC".

2. Use an A-B type USB cable to connect a computer.

Playback 3. Start play on the player.• The digital signals that can be input by this unit are linear PCM signals with a sampling frequency and quantization bit rate of 48 kHz/32 bit (operation may not be possible with all connected devices or environments).• Supported OSs of PC to be connected are Windows10

and Mac OS X.• With OSs other than the supported ones, the sound may be interrupted or may not come out.• Depending on the usage environment, playback may not be performed normally.USB DACa USB Cable> Before Start > Part Names > Install > Playback Advanced Setup | Others

Adjusting sound quality Reproduce the original sound faithfully (DIRECT mode) Processing that affects sound quality is shut down so sound closer to the original is reproduced.(Default Value): OFF1. Press DIRECT (d).• The DIRECT indicator on the front of the main unit lights when the DIRECT mode is ON.• When the DIRECT mode is ON, DIGITAL OUT is turned OFF.

  • In DIRECT mode, the display turns off automatically while playing CD or SACD, or connecting USB DAC.• When switching the setting during playback, the audio may be interrupted. DIGITAL FILTER Select one of three types of DIGITAL FILTER.1. The setting changes each time you press DIGITAL FILTER (a)."SLOW": Soft and fluid sound"SHARP" (Default Value): Sound with more structure and firmness"SHORT": Sound that starts quick and seems to move forward• You can also press SETUP (c) to display the DIGITAL FILTER setting screen from the SETUP menu. In this case, select the setting value with / (b) on the remote controller.• The setting is fixed to "SHORT" while playing MQA-CD or a disc containing music files, or using USB DAC.• When switching the setting during playback, the audio may be interrupted. UP SAMPLING Increasing the sampling frequency helps achieve sound reproduction with a higher degree of clarity.(Default Value): OFF1. You can also press UP SAMPLING (g) to turn the feature ON and OFF.• This function cannot be used when the DIRECT mode is set to ON or during playback of SACD or DSD.• The setting is fixed to "ON" while playing MQA-CD or a disc containing music files, or using USB DAC.• When switching the setting during playback, the audio may be interrupted. Adjusting the lock range (LOCK RANGE ADJUST) Sound quality is improved by narrowing the lock range to reduce incidental sounds. However, narrowing the lock range too much can cause interruptions to sound and noise. Adjust the lock range while listening to some audio.(Default Value): RANGE 61. Press LOCK RANGE (e).

2. Select the setting value with / (f) on the remote

controller."RANGE 6" (broad) to "RANGE 1" (narrow)• You can also press SETUP (c) to display the LOCK RANGE ADJUST setting screen from the SETUP menu.• The setting is fixed to "6" while playing MQA-CD or a disc containing music files, or using USB DAC.• LOCK RANGE ADJUST has no effect on the audio of SACD and DSD.• When switching the setting during playback, the audio may be interrupted.

g16 > Before Start > Part Names > Install > Playback Advanced Setup |Others Advanced Settings Advanced Setup The unit allows you to configure advanced settings to provide you with an even better experience.

1. Press SETUP on the remote controller.

2. Select the content or the setting with the cursors on the

remote controller and press ENTER to confirm your selection. To return to the previous screen, press RETURN.

3. To exit the settings, press SETUP.

You can set it so that the disc automatically starts playing when this unit is turned on.

  • By using an externally connected auto timer, you can use timer play when the power automatically switches on. "ON": To play discs automatically "OFF" (Default Value): When discs are not to be played DIGITAL OUT Make settings for digital audio output. When not connecting to the DIGITAL OUT OPTICAL/COAXIAL jack, you can listen to even clearer audio by setting this OFF. "ON" (Default Value), "OFF" DIGITAL FILTER You can select the type of DIGITAL FILTER. (P15) UP SAMPLING Increasing the sampling frequency helps achieve sound reproduction with a higher degree of clarity. (P15)

Adjust the lock range. (P15) LOADING MODE The loading time for CD can be shortened.

  • Activating this function allows loading time to be shortened depending on the CD, however, sound skipping may occur at the beginning of playback. "NORMAL" (Default Value): When the loading time for CD is not shortened "FAST": When the loading time for CD is shortened

Troubleshooting Others Before starting the procedure When operation is unstable, problems may be solved by simply turning the power on or to standby or disconnecting/connecting the power cord, rather than reviewing settings and operations. Try the simple measures on both the unit and the connected device. If the problem isn't fixed after referring to "Troubleshooting", resetting the unit to the status at the time of shipment may solve the problem. Resetting the unit (this resets the unit settings to the default) 1. With the power on and no disc inserted, while pressing and holding g on the main unit, press DIRECT.2. "CLEAR" is displayed, the unit switches to standby, and the settings are reset. ■ Power Cannot turn on the unit• Unplug the power cord from the wall outlet, wait 2 minutes or more, then plug it in again.The unit turns off unexpectedly• The unit automatically switches to standby when the "AUTO STANDBY" setting in the SETUP menu functions.The STANDBY indicator on the main unit continues to flash red and operations are not possible• Unplug the power cord from the wall outlet, wait 2 minutes or more, then plug it in again. The indicator will continue to flash, but press 8 STANDBY/ON on the main unit to turn the main power ON. If this doesn't fix the issue, there may be a malfunction. Unplug the power cord from the wall outlet and contact the dealer or our customer support. ■ The display doesn't light

  • It is possible that the display has been turned off by pressing DISPLAY OFF. Press DISPLAY OFF to turn the display on. ■ Cannot play discs
  • Place the disc in the disc tray so the label is facing up.• Play may not be possible if the disc is scratched or dirty.• Sound files that are protected by copyright cannot be played.• The disc tray opens if you insert a disc that this unit does not support. ■ Audio Sound is interrupted• Narrowing the lock range too much with the LOCK RANGE ADJUST setting can cause interruptions to sound and also may cause noise. Sound interruptions caused by adjustments to the lock range are not covered by our guarantees of operation. Listen to some audio while adjusting the lock range.There is no digital sound• Set "DIGITAL OUT" in the SETUP menu to "ON".• The audio of SACD and DSD or input from USB DAC is not digital-output. ■ Remote Controller
  • Make sure that the batteries are installed with the correct polarity.• Install new batteries. Do not mix different types of batteries, or old and new batteries.• Make sure that this unit is not subjected to direct sunshine or inverter-type fluorescent lights. Relocate if necessary.• If this unit is installed in a rack or cabinet with colored-glass doors or if the doors are closed, the remote controller may not work reliably. ■ D/A converter feature
  • Make sure that the devices are properly connected.• Play audio compatible with the input jacks on this unit. (P14)Cannot play audio from computers• Cancel the muting on your computer.• Select this unit in the audio output settings on your computer. If the source of this unit is set to anything other than "USB DAC", the PC cannot detect this unit.• If there are multiple applications running on the computer, shut down those applications that you are not using. Sampling frequency is always the same through the USB DAC input• Depending on the computer settings, even if the sampling frequencies of the files being played are different, they are converted to the same sampling frequency for output. Computer sounds other than music are heard through the USB DAC input• Depending on the settings on the computer, sounds such as the computer startup tone or error sounds may be played through this unit. ■ SACD
  • Due to the differences in recording methods, there may be a difference in volume between SACD and CD. CLEAR18 > Before Start > Part Names > Install > Playback Advanced Setup | Others Other notes ■ Discs that can be played Precautions for Playback
  • Compact discs (CDs) with the following logo on the label surface can be used.
  • Note that some discs may not play back because of the disc characteristics, scratches, contamination or the recording state. Playing MQA This unit includes the MQA (Master Quality Authenticated) technology, which enables playback of MQA audio files and streams, delivering the sound of the original master recording. This unit is a CD player that can recognise an MQA-CD. The built-in MQA decoder will restore the high-resolution signal heard in the studio and confirm it, using the authentication signature. Visit www.mqa.co.uk/customer/mqacd for more information. ‘MQA’ or ‘MQA.’ indicates that the product is decoding and playing an MQA stream or file, and denotes provenance to ensure that the sound is identical to that of the source material. ‘MQA.’ indicates it is playing an MQA Studio file, which has either been approved in the studio by the artist/ producer or has been verified by the copyright owner. Playing hybrid SACD Hybrid SACD consist of two layers; the SACD layer and the CD layer. Press CD/SACD to select the layer you want to listen to. Playing DualDisks "DualDisk" is a disc with video and audio conforming to the DVD standard on one side, and audio that can be played on a CD player on the other. On the audio side that is not the DVD side, play may not always be possible due to the fact that the disc does not conform to the physical specifications of standard CDs. Operations during play Direct search does not work while playing discs with music data. Types of discs that cannot be played on this unit DVD Video, DVD Audio, CD-G, Video CD, DTS-CD Notes on discs
  • Be careful not to catch your hand or fingers when opening or closing the disc tray.
  • Never use discs which have an unusual shape (such as hearts or octagons). These types of discs could jam and damage the unit.
  • Some audio CDs with copy-control functionality do not comply with official CD standards. These are special discs and cannot be played with this unit.
  • Do not use discs with residue from cellophane tape, rental discs with labels which are peeling off, or discs with decorative labels. This type of disc could get stuck in the unit, or could damage the unit.
  • Do not leave a disc having a label printed with an inkjet printer in the unit for a long time. The disc could get stuck in the unit, or could damage the unit. ■ Cleaning the player
  • Normally, wipe the player with a soft cloth. For tough dirt, apply some neutral detergent diluted in 5 to 6 parts water to a soft cloth, wring out thoroughly, wipe off the dirt, then wipe again with a dry cloth.
  • Note that getting alcohol, thinner, benzene or insecticide on the player could cause the print and coating to peel off. Also, avoid leaving rubber or vinyl products in contact with the player for long periods of time, as this could damage the cabinet.
  • When using chemical-impregnated wipes, etc., read the wipe’s cautions carefully.
  • When dust attached on the disc tray is hard to remove, apply an adhesive tape, etc. to remove the dust. ■ Precautions when moving the unit When moving the unit, remove any discs in it and close the disc tray. Then press 8 STANDBY/ON on the main unit, wait for 10 seconds after [OFF] disappears from the display, and then unplug the power cord. Moving the unit while a disc is still in it may cause damage. ■ Condensation Drops of water can form inside this unit if it is taken from a cold place to a warm room or when a cold room is rapidly warmed by a heater. This is called condensation. This may not only cause the unit to malfunction, but it can also damage the disc or parts of the unit. We recommend removing discs from the unit if it is not to be used for a while. If there is a possibility that condensation has formed, unplug the power cord and allow the unit to stand for at least 3 hours at room temperature. MQA-CD SACD (Super Audio CD) (2-channel area only) CD, CD-R, CD-RW

General Specifications ■ Analog Audio Output Rated Output Level and Impedance

  • RCA OUT : 2.3 Vrms (1 kHz, 0 dB) / 100 Frequency Response
  • CD: 2 Hz - 20 kHz, SACD: 2 Hz - 50 kHz (-3 dB) Signal to Noise Ratio
  • CD: 116 dB or more (A-weighting), SACD: 116 dB or more (A-weighting) THD+N

HORVPDOWLPHQWRGLYHFFKLGLVSRVLWLYLHEDWWHULH HVDXVWH

  • CD: 116 dB of meer (A-weging), SACD: 116 dB of meer (A-weging) THD+N

Version 2.1, February 1999 Copyright (C) 1991, 1999 Free Software Foundation, Inc. 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA Everyone is permitted to copy and distribute verbatim copies of this license document, but changing it is not allowed. [This is the first released version of the Lesser GPL. It also counts as the successor of the GNU Library Public License, version 2, hence the version number 2.1.] Preamble The licenses for most software are designed to take away your freedom to share and change it. By contrast, the GNU General Public Licenses are intended to guarantee your freedom to share and change free software--to make sure the software is free for all its users. This license, the Lesser General Public License, applies to some specially designated software packages--typically libraries--of the Free Software Foundation and other authors who decide to use it. You can use it too, but we suggest you first think carefully about whether this license or the ordinary General Public License is the better strategy to use in any particular case, based on the explanations below. When we speak of free software, we are referring to freedom of use, not price. Our General Public Licenses are designed to make sure that you have the freedom to distribute copies of free software (and charge for this service if you wish); that you receive source code or can get it if you want it; that you can change the software and use pieces of it in new free programs; and that you are informed that you can do these things. To protect your rights, we need to make restrictions that forbid distributors to deny you these rights or to ask you to surrender these rights. These restrictions translate to certain responsibilities for you if you distribute copies of the library or if you modify it. For example, if you distribute copies of the library, whether gratis or for a fee, you must give the recipients all the rights that we gave you. You must make sure that they, too, receive or can get the source code. If you link other code with the library, you must provide complete object files to the recipients, so that they can relink them with the library after making changes to the library and recompiling it. And you must show them these terms so they know their rights. We protect your rights with a two-step method: (1) we copyright the library, and (2) we offer you this license, which gives you legal permission to copy, distribute and/or modify the library. To protect each distributor, we want to make it very clear that there is no warranty for the free library. Also, if the library is modified by someone else and passed on, the recipients should know that what they have is not the original version, so that the original author's reputation will not be affected by problems that might be introduced by others. Finally, software patents pose a constant threat to the existence of any free program. We wish to make sure that a company cannot effectively restrict the users of a free program by obtaining a restrictive license from a patent holder. Therefore, we insist that any patent license obtained for a version of the library must be consistent with the full freedom of use specified in this license. Most GNU software, including some libraries, is covered by the ordinary GNU General Public License. This license, the GNU Lesser General Public License, applies to certain designated libraries, and is quite different from the ordinary General Public License. We use this license for certain libraries in order to permit linking those libraries into non-free programs. When a program is linked with a library, whether statically or using a shared library, the combination of the two is legally speaking a combined work, a derivative of the original library. The ordinary General Public License therefore permits such linking only if the entire combination fits its criteria of freedom. The Lesser General Public License permits more lax criteria for linking other code with the library. We call this license the "Lesser" General Public License because it does Less to protect the user's freedom than the ordinary General Public License. It also provides other free software developers Less of an advantage over competing non-free programs. These disadvantages are the reason we use the ordinary General Public License for many libraries. However, the Lesser license provides advantages in certain special circumstances. For example, on rare occasions, there may be a special need to encourage the widest possible use of a certain library, so that it becomes a de-facto standard. To achieve this, non- free programs must be allowed to use the library. A more frequent case is that a free library does the same job as widely used non-free libraries. In this case, there is little to gain by limiting the free library to free software only, so we use the Lesser General Public License. In other cases, permission to use a particular library in non-free programs enables a greater number of people to use a large body of free software. For example, permission to use the GNU C Library in non-free programs enables many more people to use the whole GNU operating system, as well as its variant, the GNU/Linux operating system. Although the Lesser General Public License is Less protective of the users' freedom, it does ensure that the user of a program that is linked with the Library has the freedom and the wherewithal to run that program using a modified version of the Library. The precise terms and conditions for copying, distribution and modification follow. Pay close attention to the difference between a "work based on the library" and a "work that uses the library". The former contains code derived from the library, whereas the latter must be combined with the library in order to run. TERMS AND CONDITIONS FOR COPYING, DISTRIBUTION AND MODIFICATION

0. This License Agreement applies to any software library or other program which contains a notice placed by the

copyright holder or other authorized party saying it may be distributed under the terms of this Lesser General Public License (also called "this License"). Each licensee is addressed as "you". A "library" means a collection of software functions and/or data prepared so as to be conveniently linked with application programs (which use some of those functions and data) to form executables. The "Library", below, refers to any such software library or work which has been distributed under these terms. A "work based on the Library" means either the Library or any derivative work under copyright law: that is to say, a work containing the Library or a portion of it, either verbatim or with modifications and/or translated straightforwardly into another language. (Hereinafter, translation is included without limitation in the term "modification".) "Source code" for a work means the preferred form of the work for making modifications to it. For a library, complete source code means all the source code for all modules it contains, plus any associated interface definition files, plus the scripts used to control compilation and installation of the library. Activities other than copying, distribution and modification are not covered by this License; they are outside its scope. The act of running a program using the Library is not restricted, and output from such a program is covered only if its contents constitute a work based on the Library (independent of the use of the Library in a tool for writing it). Whether that is true depends on what the Library does and what the program that uses the Library does.

1. You may copy and distribute verbatim copies of the Library's complete source code as you receive it, in any

medium, provided that you conspicuously and appropriately publish on each copy an appropriate copyright notice and disclaimer of warranty; keep intact all the notices that refer to this License and to the absence of any warranty; and distribute a copy of this License along with the Library. You may charge a fee for the physical act of transferring a copy, and you may at your option offer warranty protection in exchange for a fee.

2. You may modify your copy or copies of the Library or any portion of it, thus forming a work based on the Library, and

copy and distribute such modifications or work under the terms of Section 1 above, provided that you also meet all of these conditions: a) The modified work must itself be a software library. b) You must cause the files modified to carry prominent notices stating that you changed the files and the date of any change. c) You must cause the whole of the work to be licensed at no charge to all third parties under the terms of this License

If a facility in the modified Library refers to a function or a table of data to be supplied by an application program that uses the facility, other than as an argument passed when the facility is invoked, then you must make a good faith effort to ensure that, in the event an application does not supply such function or table, the facility still operates, and performs whatever part of its purpose remains meaningful. (For example, a function in a library to compute square roots has a purpose that is entirely well-defined independent of the application. Therefore, Subsection 2d requires that any application-supplied function or table used by this function must be optional: if the application does not supply it, the square root function must still compute square roots.) These requirements apply to the modified work as a whole. If identifiable sections of that work are not derived from the Library, and can be reasonably considered independent and separate works in themselves, then this License, and its terms, do not apply to those sections when you distribute them as separate works. But when you distribute the same sections as part of a whole which is a work based on the Library, the distribution of the whole must be on the terms of this License, whose permissions for other licensees extend to the entire whole, and thus to each and every part regardless of who wrote it. Thus, it is not the intent of this section to claim rights or contest your rights to work written entirely by you; rather, the intent is to exercise the right to control the distribution of derivative or collective works based on the Library. In addition, mere aggregation of another work not based on the Library with the Library (or with a work based on the Library) on a volume of a storage or distribution medium does not bring the other work under the scope of this License.

3. You may opt to apply the terms of the ordinary GNU General Public License instead of this License to a given copy

of the Library. To do this, you must alter all the notices that refer to this License, so that they refer to the ordinary GNU General Public License, version 2, instead of to this License. (If a newer version than version 2 of the ordinary GNU General Public License has appeared, then you can specify that version instead if you wish.) Do not make any other change in these notices. Once this change is made in a given copy, it is irreversible for that copy, so the ordinary GNU General Public License applies to all subsequent copies and derivative works made from that copy. This option is useful when you wish to copy part of the code of the Library into a program that is not a library.

4. You may copy and distribute the Library (or a portion or derivative of it, under Section 2) in object code or

executable form under the terms of Sections 1 and 2 above provided that you accompany it with the complete corresponding machine-readable source code, which must be distributed under the terms of Sections 1 and 2 above on a medium customarily used for software interchange. If distribution of object code is made by offering access to copy from a designated place, then offering equivalent access to copy the source code from the same place satisfies the requirement to distribute the source code, even though third parties are not compelled to copy the source along with the object code. 5. A program that contains no derivative of any portion of the Library, but is designed to work with the Library by being compiled or linked with it, is called a "work that uses the Library". Such a work, in isolation, is not a derivative work of the Library, and therefore falls outside the scope of this License. However, linking a "work that uses the Library" with the Library creates an executable that is a derivative of the Library (because it contains portions of the Library), rather than a "work that uses the library". The executable is therefore covered by this License. Section 6 states terms for distribution of such executables. When a "work that uses the Library" uses material from a header file that is part of the Library, the object code for the work may be a derivative work of the Library even though the source code is not. Whether this is true is especially significant if the work can be linked without the Library, or if the work is itself a library. The threshold for this to be true is not precisely defined by law. If such an object file uses only numerical parameters, data structure layouts and accessors, and small macros and small inline functions (ten lines or less in length), then the use of the object file is unrestricted, regardless of whether it is legally a derivative work. (Executables containing this object code plus portions of the Library will still fall under Section 6.) Otherwise, if the work is a derivative of the Library, you may distribute the object code for the work under the terms of Section 6. Any executables containing that work also fall under Section 6, whether or not they are linked directly with the Library itself.

6. As an exception to the Sections above, you may also combine or link a "work that uses the Library" with the Library

to produce a work containing portions of the Library, and distribute that work under terms of your choice, provided that the terms permit modification of the work for the customer's own use and reverse engineering for debugging such modifications. You must give prominent notice with each copy of the work that the Library is used in it and that the Library and its use are covered by this License. You must supply a copy of this License. If the work during execution displays copyright notices, you must include the copyright notice for the Library among them, as well as a reference directing the user to the copy of this License. Also, you must do one of these things:

Accompany the work with the complete corresponding machine-readable source code for the Library including whatever changes were used in the work (which must be distributed under Sections 1 and 2 above); and, if the work is an executable linked with the Library, with the complete machine-readable "work that uses the Library", as object code and/or source code, so that the user can modify the Library and then relink to produce a modified executable containing the modified Library. (It is understood that the user who changes the contents of definitions files in the Library will not necessarily be able to recompile the application to use the modified definitions.) b) Use a suitable shared library mechanism for linking with the Library. A suitable mechanism is one that (1) uses at run time a copy of the library already present on the user's computer system, rather than copying library functions into the executable, and (2) will operate properly with a modified version of the library, if the user installs one, as long as the modified version is interface-compatible with the version that the work was made with. c) Accompany the work with a written offer, valid for at least three years, to give the same user the materials specified in Subsection 6a, above, for a charge no more than the cost of performing this distribution. d) If distribution of the work is made by offering access to copy from a designated place, offer equivalent access to copy the above specified materials from the same place. e) Verify that the user has already received a copy of these materials or that you have already sent this user a copy. For an executable, the required form of the "work that uses the Library" must include any data and utility programs needed for reproducing the executable from it. However, as a special exception, the materials to be distributed need not include anything that is normally distributed (in either source or binary form) with the major components (compiler, kernel, and so on) of the operating system on which the executable runs, unless that component itself accompanies the executable. It may happen that this requirement contradicts the license restrictions of other proprietary libraries that do not normally accompany the operating system. Such a contradiction means you cannot use both them and the Library together in an executable that you distribute.

7. You may place library facilities that are a work based on the Library side-by-side in a single library together with

other library facilities not covered by this License, and distribute such a combined library, provided that the separate distribution of the work based on the Library and of the other library facilities is otherwise permitted, and provided that you do these two things: a) Accompany the combined library with a copy of the same work based on the Library, uncombined with any other library facilities. This must be distributed under the terms of the Sections above. b) Give prominent notice with the combined library of the fact that part of it is a work based on the Library, and explaining where to find the accompanying uncombined form of the same work.

8. You may not copy, modify, sublicense, link with, or distribute the Library except as expressly provided under this

License. Any attempt otherwise to copy, modify, sublicense, link with, or distribute the Library is void, and will21 automatically terminate your rights under this License. However, parties who have received copies, or rights, from you under this License will not have their licenses terminated so long as such parties remain in full compliance.

9. You are not required to accept this License, since you have not signed it. However, nothing else grants you

permission to modify or distribute the Library or its derivative works. These actions are prohibited by law if you do not accept this License. Therefore, by modifying or distributing the Library (or any work based on the Library), you indicate your acceptance of this License to do so, and all its terms and conditions for copying, distributing or modifying the Library or works based on it.

Each time you redistribute the Library (or any work based on the Library), the recipient automatically receives a license from the original licensor to copy, distribute, link with or modify the Library subject to these terms and conditions. You may not impose any further restrictions on the recipients' exercise of the rights granted herein. You are not responsible for enforcing compliance by third parties with this License.

If, as a consequence of a court judgment or allegation of patent infringement or for any other reason (not limited to patent issues), conditions are imposed on you (whether by court order, agreement or otherwise) that contradict the conditions of this License, they do not excuse you from the conditions of this License. If you cannot distribute so as to satisfy simultaneously your obligations under this License and any other pertinent obligations, then as a consequence you may not distribute the Library at all. For example, if a patent license would not permit royalty-free redistribution of the Library by all those who receive copies directly or indirectly through you, then the only way you could satisfy both it and this License would be to refrain entirely from distribution of the Library. If any portion of this section is held invalid or unenforceable under any particular circumstance, the balance of the section is intended to apply, and the section as a whole is intended to apply in other circumstances. It is not the purpose of this section to induce you to infringe any patents or other property right claims or to contest validity of any such claims; this section has the sole purpose of protecting the integrity of the free software distribution system which is implemented by public license practices. Many people have made generous contributions to the wide range of software distributed through that system in reliance on consistent application of that system; it is up to the author/donor to decide if he or she is willing to distribute software through any other system and a licensee cannot impose that choice. This section is intended to make thoroughly clear what is believed to be a consequence of the rest of this License.

If the distribution and/or use of the Library is restricted in certain countries either by patents or by copyrighted interfaces, the original copyright holder who places the Library under this License may add an explicit geographical distribution limitation excluding those countries, so that distribution is permitted only in or among countries not thus excluded. In such case, this License incorporates the limitation as if written in the body of this License.

The Free Software Foundation may publish revised and/or new versions of the Lesser General Public License from time to time. Such new versions will be similar in spirit to the present version, but may differ in detail to address new problems or concerns. Each version is given a distinguishing version number. If the Library specifies a version number of this License which applies to it and "any later version", you have the option of following the terms and conditions either of that version or of any later version published by the Free Software Foundation. If the Library does not specify a license version number, you may choose any version ever published by the Free Software Foundation.

If you wish to incorporate parts of the Library into other free programs whose distribution conditions are incompatible with these, write to the author to ask for permission. For software which is copyrighted by the Free Software Foundation, write to the Free Software Foundation; we sometimes make exceptions for this. Our decision will be guided by the two goals of preserving the free status of all derivatives of our free software and of promoting the sharing and reuse of software generally. * NO WARRANTY

END OF TERMS AND CONDITIONS

How to Apply These Terms to Your New Libraries If you develop a new library, and you want it to be of the greatest possible use to the public, we recommend making it free software that everyone can redistribute and change. You can do so by permitting redistribution under these terms (or, alternatively, under the terms of the ordinary General Public License). To apply these terms, attach the following notices to the library. It is safest to attach them to the start of each source file to most effectively convey the exclusion of warranty; and each file should have at least the "copyright" line and a pointer to where the full notice is found. <one line to give the library's name and an idea of what it does.> Copyright (C) <year> <name of author> This library is free software; you can redistribute it and/or modify it under the terms of the GNU Lesser General Public License as published by the Free Software Foundation; either version 2.1 of the License, or (at your option) any later version. This library is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Lesser General Public License for more details. You should have received a copy of the GNU Lesser General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA Also add information on how to contact you by electronic and paper mail. You should also get your employer (if you work as a programmer) or your school, if any, to sign a "copyright disclaimer" for the library, if necessary. Here is a sample; alter the names: Yoyodyne, Inc., hereby disclaims all copyright interest in the library `Frob' (a library for tweaking knobs) written by James Random Hacker. signature of Ty Coon, 1 April 1990 Ty Coon, President of Vice That's all there is to it!

GNU GENERAL PUBLIC LICENSE

Version 2, June 1991 Copyright (C) 1989, 1991 Free Software Foundation, Inc.59 Temple Place - Suite 330, Boston, MA 02111-1307, USA Everyone is permitted to copy and distribute verbatim copies of this license document, but changing it is not allowed. Preamble The licenses for most software are designed to take away your freedom to share and change it. By contrast, the GNU General Public License is intended to guarantee your freedom to share and change free software--to make sure the software is free for all its users. This General Public License applies to most of the Free Software Foundation's software and to any other program whose authors commit to using it. (Some other Free Software Foundation software is covered by the GNU Library General Public License instead.) You can apply it to your programs, too. When we speak of free software, we are referring to freedom, not price. Our General Public Licenses are designed to make sure that you have the freedom to distribute copies of free software (and charge for this service if you wish), that you receive source code or can get it if you want it, that you can change the software or use pieces of it in new free programs; and that you know you can do these things. To protect your rights, we need to make restrictions that forbid anyone to deny you these rights or to ask you to surrender the rights. These restrictions translate to certain responsibilities for you if you distribute copies of the software, or if you modify it. For example, if you distribute copies of such a program, whether gratis or for a fee, you must give the recipients all the rights that you have. You must make sure that they, too, receive or can get the source code. And you must show them these terms so they know their rights. We protect your rights with two steps: (1) copyright the software, and (2) offer you this license which gives you legal permission to copy, distribute and/or modify the software. Also, for each author's protection and ours, we want to make certain that everyone understands that there is no warranty for this free software. If the software is modified by someone else and passed on, we want its recipients to know that what they have is not the original, so that any problems introduced by others will not reflect on the original authors' reputations. Finally, any free program is threatened constantly by software patents. We wish to avoid the danger that redistributors of a free program will individually obtain patent licenses, in effect making the program proprietary. To prevent this, we have made it clear that any patent must be licensed for everyone's free use or not licensed at all. The precise terms and conditions for copying, distribution and modification follow. TERMS AND CONDITIONS FOR COPYING, DISTRIBUTION AND MODIFICATION

0. This License applies to any program or other work which contains a notice placed by the copyright holder saying it

may be distributed under the terms of this General Public License. The "Program", below, refers to any such program or work, and a "work based on the Program" means either the Program or any derivative work under copyright law: that is to say, a work containing the Program or a portion of it, either verbatim or with modifications and/or translated into another language. (Hereinafter, translation is included without limitation in the term "modification".) Each licensee is addressed as "you". Activities other than copying, distribution and modification are not covered by this License; they are outside its scope. The act of running the Program is not restricted, and the output from the Program is covered only if its contents constitute a work based on the Program (independent of having been made by running the Program). Whether that is true depends on what the Program does.

1. You may copy and distribute verbatim copies of the Program's source code as you receive it, in any medium,

provided that you conspicuously and appropriately publish on each copy an appropriate copyright notice and disclaimer of warranty; keep intact all the notices that refer to this License and to the absence of any warranty; and give any other recipients of the Program a copy of this License along with the Program. You may charge a fee for the physical act of transferring a copy, and you may at your option offer warranty protection in exchange for a fee.

2. You may modify your copy or copies of the Program or any portion of it, thus forming a work based on the Program,

and copy and distribute such modifications or work under the terms of Section 1 above, provided that you also meet all of these conditions: a) You must cause the modified files to carry prominent notices stating that you changed the files and the date of any change. b) You must cause any work that you distribute or publish, that in whole or in part contains or is derived from the Program or any part thereof, to be licensed as a whole at no charge to all third parties under the terms of this License. c) If the modified program normally reads commands interactively when run, you must cause it, when started running for such interactive use in the most ordinary way, to print or display an announcement including an appropriate copyright notice and a notice that there is no warranty (or else, saying that you provide a warranty) and that users may redistribute the program under these conditions, and telling the user how to view a copy of this License. (Exception: if the Program itself is interactive but does not normally print such an announcement, your work based on the Program is not required to print an announcement.) These requirements apply to the modified work as a whole. If identifiable sections of that work are not derived from the Program, and can be reasonably considered independent and separate works in themselves, then this License, and its terms, do not apply to those sections when you distribute them as separate works. But when you distribute the same sections as part of a whole which is a work based on the Program, the distribution of the whole must be on the terms of this License, whose permissions for other licensees extend to the entire whole, and thus to each and every part regardless of who wrote it. Thus, it is not the intent of this section to claim rights or contest your rights to work written entirely by you; rather, the intent is to exercise the right to control the distribution of derivative or collective works based on the Program. In addition, mere aggregation of another work not based on the Program with the Program (or with a work based on the Program) on a volume of a storage or distribution medium does not bring the other work under the scope of this License.

3. You may copy and distribute the Program (or a work based on it, under Section 2) in object code or executable form

under the terms of Sections 1 and 2 above provided that you also do one of the following: a) Accompany it with the complete corresponding machine-readable source code, which must be distributed under the terms of Sections 1 and 2 above on a medium customarily used for software interchange;or, b) Accompany it with a written offer, valid for at least three years, to give any third party, for a charge no more than your cost of physically performing source distribution, a complete machine-readable copy of the corresponding source code, to be distributed under the terms of Sections 1 and 2 above on a medium customarily used for software interchange; or, c) Accompany it with the information you received as to the offer to distribute corresponding source code. (This alternative is allowed only for noncommercial distribution and only if you received the program in object code or executable form with such an offer, in accord with Subsection b above.) The source code for a work means the preferred form of the work for making modifications to it. For an executable work, complete source code means all the source code for all mo dules it contains, plus any associated interface definition files, plus the scripts used to control compilation and installation of the executable. However, as a special exception, the source code distributed need not include anything that is normally distributed (in either source or binary form) with the major components (compiler, kernel, and so on) of the operating system on which the executable runs, unless that component itself accompanies the executable. If distribution of executable or object code is made by offering access to copy from a designated place, then offering equivalent access to copy the source code from the same place counts as distribution of the source code, even though third parties are not compelled to copy the source along with the object code.

You may not copy, modify, sublicense, or distribute the Program except as expressly provided under this License. Any attempt otherwise to copy, modify, sublicense or distribute the Program is void, and will automatically terminate your rights under this License. However, parties who have received copies, or rights, from you under this License will not have their licenses terminated so long as such parties remain in full compliance.

5. You are not required to accept this License, since you have not signed it. However, nothing else grants you

permission to modify or distribute the Program or its derivative works. These actions are prohibited by law if you do not accept this License. Therefore, by modifying or distributing the Program (or any work based on the Program), you indicate your acceptance of this License to do so, and all its terms and conditions for copying, distributing or modifying the Program or works based on it.

Each time you redistribute the Program (or any work based on the Program), the recipient automatically receives a license from the original licensor to copy, distribute or modify the Program subject to these terms and conditions. You may not impose any further restrictions on the recipients' exercise of the rights granted herein. You are not responsible for enforcing compliance by third parties to this License.

7. If, as a consequence of a court judgment or allegation of patent infringement or for any other reason (not limited to

patent issues), conditions are imposed on you (whether by court order, agreement or otherwise) that contradict the conditions of this License, they do not excuse you from the conditions of this License. If you cannot distribute so as to satisfy simultaneously your obligations under this License and any other pertinent obligations, then as a consequence you may not distribute the Program at all. For example, if a patent license would not permit royalty- free redistribution of the Program by all those who receive copies directly or indirectly through you, then the only way you could satisfy both it and this License would be to refrain entirely from distribution of the Program. If any portion of this section is held invalid or unenforceable under any particular circumstance, the balance of the section is intended to apply and the section as a whole is intended to apply in other circumstances. It is not the purpose of this section to induce you to infringe any patents or other property right claims or to contest validity of any such claims; this section has the sole purpose of protecting the integrity of the free software distribution system, which is implemented by public license practices. Many people have made generous contributions to the wide range of software distributed through that system in reliance on consistent application of that system; it is up to the author/donor to decide if he or she is willing to distribute software through any other system and a licensee cannot impose that choice. This section is intended to make thoroughly clear what is believed to be a consequence of the rest of this License.

8. If the distribution and/or use of the Program is restricted in certain countries either by patents or by copyrighted

interfaces, the original copyright holder who places the Program under this License may add an explicit geographical distribution limitation excluding those countries, so that distribution is permitted only in or among countries not thus excluded. In such case, this License incorporates the limitation as if written in the body of this License.

9. The Free Software Foundation may publish revised and/or new versions of the General Public License from time to

time. Such new versions will be similar in spirit to the present version, but may differ in detail to address new problems or concerns. Each version is given a distinguishing version number. If the Program specifies a version number of this License which applies to it and "any later version", you have the option of following the terms and conditions either of that version or of any later version published by the Free Software Foundation. If the Program does not specify a version number of this License, you may choose any version ever published by the Free Software Foundation.

If you wish to incorporate parts of the Program into other free programs whose distribution conditions are different, write to the author to ask for permission. For software which is copyrighted by the Free Software Foundation, write to the Free Software Foundation; we sometimes make exceptions for this. Our decision will be guided by the two goals of preserving the free status of all derivatives of our free software and of promoting the sharing and reuse of software generally. NO WARRANTY

END OF TERMS AND CONDITIONS

How to Apply These Terms to Your New Programs If you develop a new program, and you want it to be of the greatest possible use to the public, the best way to achieve this is to make it free software which everyone can redistribute and change under these terms. To do so, attach the following notices to the program. It is safest to attach them to the start of each source file to most effectively convey the exclusion of warranty; and each file should have at least the "copyright" line and a pointer to where the full notice is found. <one line to give the program's name and an idea of what it does.> Copyright (C) <year> <name of author> This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA. Also add information on how to contact you by electronic and paper mail. If the program is interactive, make it output a short notice like this when it starts in an interactive mode: Gnomovision version 69, Copyright (C) year name of author Gnomovision comes with ABSOLUTELY NO WARRANTY; for details type `show w'. This is free software, and you are welcome to redistribute it under certain conditions; type `show c' for details. The hypothetical commands `show w' and `show c' should show the appropriate parts of the General Public License. Of course, the commands you use may be called something other than `show w' and `show c'; they could even be mouse-clicks or menu items--whatever suits your program. You should also get your employer (if you work as a programmer) or your school, if any, to sign a "copyright disclaimer" for the program, if necessary. Here is a sample; alter the names: Yoyodyne, Inc., hereby disclaims all copyright interest in the program `Gnomovision' (which makes passes at compilers) written by James Hacker. <signature of Ty Coon>, 1 April 1989 Ty Coon, President of Vice This General Public License does not permit incorporating your program into proprietary programs. If your program is a subroutine library, you may consider it more useful to permit linking proprietary applications with the library. If this is what you want to do, use the GNU Library General Public License instead of this License. Notice Regarding Third-party Software / その他第三者ソフトウェアに関するお知らせ This product includes the following software that is directly or indirectly licensed to O&P Corporation by third-party developers. Please refer to the PDF files on the following website about the notice in response to requests from the copyright owners of each piece of software. https://www.onkyo.com/manual/oss/2017pd.pdf 本製品には弊社が第三者より直接的に又は間接的に使用の許諾を受けた下記ソフトウェアが含まれておりま す。各ソフトウェアの著作権者の要求に基づく通知については、以下のサイトより PDF ファイルをご参照く