Vivotek FD8166-F6 - Security Camera

FD8166-F6 - Security Camera Vivotek - Free user manual and instructions

Find the device manual for free FD8166-F6 Vivotek in PDF.

📄 195 pages English EN Download 💬 AI Question 10 questions ⚙️ Specs
Notice Vivotek FD8166-F6 - page 4
Pick your language and provide your email: we'll send you a specifically translated version.
Product Type Indoor Network Fixed Dome Camera
Model FD8166-F6 (Lens f=6mm)
Image Sensor 1/2.7" Progressive CMOS
Maximum Resolution 1920x1080 (2MP)
Lens Type Fixed-focal, F1.6
Field of View 56° (H) x 31° (V) x 64° (D)
Minimum Illumination 0.18 Lux (50 IRE)
Shutter Time 1/5 sec to 1/32,000 sec
Pan / Tilt Range Pan: 45° / Tilt: 33°~90°
ePTZ Zoom 48x digital zoom (4x on IE plug-in, 12x built-in)
Video Compression H.264 & MJPEG
Max Frame Rate 15fps @ 1920x1080 (H.264/MJPEG)
Audio Built-in microphone, G.711 compression, 5m range
Network Interface 10Base-T/100BaseTX Ethernet (RJ-45)
Power Supply Power over Ethernet (PoE) IEEE 802.3af Class 1
Power Consumption Max 2.9W
Dimensions ∅90mm x 50mm
Weight 144g (net)
Operating Temperature 0°C to 50°C (32°F to 122°F)
On-board Storage MicroSD/SDHC/SDXC card slot
Intelligent Video Triple-window motion detection, tampering detection
Alarm Triggers Motion, manual, digital input, periodic, system boot, recording notification, tampering
Alarm Events HTTP, SMTP, FTP, NAS server file upload
Safety Certifications CE, LVD, FCC Class B, VCCI, C-Tick
Maintenance & Cleaning Clean dome cover with a clean, soft cotton cloth. Avoid using harsh chemicals.
Spare Parts & Repairability Contact VIVOTEK or authorized dealers for spare parts and repair services.

Frequently Asked Questions - FD8166-F6 Vivotek

How do I reset the Vivotek FD8166-F6 to factory defaults?
Press and hold the recessed reset button until the status LED rapidly blinks. All settings will be restored to factory defaults.
What is the maximum video resolution and frame rate?
The maximum resolution is 1920x1080 at 15 fps for both H.264 and MJPEG. At 1280x720, it can achieve 30 fps.
Can I use the camera without a PoE switch?
Yes, you can use a PoE power injector between the camera and a non-PoE switch.
How do I access the camera over the Internet?
Set up port forwarding on your router for HTTP (default 80) and RTSP (default 554). Use the public IP address and secondary HTTP port to access from the Internet.
What types of storage does the camera support?
It supports MicroSD, SDHC, and SDXC cards up to 32GB (SDHC) and higher capacities (SDXC).
How do I set up motion detection?
Go to Configuration > Applications > Motion detection. Up to three windows can be configured. Adjust sensitivity and percentage, and define trigger actions.
Can I view the camera on my smartphone?
Yes, you can use RTSP players like VLC or QuickTime on 3GPP-compatible mobile devices. Configure stream 2 with reduced settings for mobile viewing.
How do I upgrade the firmware?
Download the latest .pkg file from VIVOTEK. Go to Configuration > System > Maintenance > Upgrade firmware, select the file, and click Upgrade. Do not power off during the process.
What is the field of view for the FD8166-F6?
With the 6mm lens, the field of view is 56° horizontal, 31° vertical, and 64° diagonal.
How do I enable privacy masking?
Go to Configuration > Media > Image > Privacy mask. Create up to 5 windows, size and position them to block sensitive areas, then enable the feature.

User questions about FD8166-F6 Vivotek

0 question about this device. Answer the ones you know or ask your own.

Ask a new question about this device

The email remains private: it is only used to notify you if someone responds to your question.

No questions yet. Be the first to ask one.

Download the instructions for your Security Camera in PDF format for free! Find your manual FD8166-F6 - Vivotek and take your electronic device back in hand. On this page are published all the documents necessary for the use of your device. FD8166-F6 by Vivotek.

USER MANUAL FD8166-F6 Vivotek

2MP • Stylish Design • Easy Installation

VIVOEK

Rev. 1.0

Table of Contents

Overview......4

Revision History 4

Read Before Use....5

Package Contents 5

Symbols and Statements in this Document....5

Physical Description....6

Installation 8

Network Deployment....10

Software Installation....12

Ready to Use....13

Accessing the Network Camera 16

Using Web Browsers 16

Using RTSP Players....19

Using 3GPP-compatible Mobile Devices....20

Using VIVOTEK Recording Software 21

Main Page 22

Go to....26

Client Settings 27

Configuration....31

System > General settings 32

System > Maintenance....40

Media > Image 44

Media > Video 50

Media > Video 51

Media >Audio....55

Network > General settings 56

Network > Streaming protocols 63

Network > SNMP (Simple Network Management Protocol)....72

Security > User Account....73

Security > HTTPS (Hypertext Transfer Protocol over SSL) 74

Security > Access List 82

PTZ > PTZ settings 87

Event > Event settings....91

Applications > Motion detection....104

Applications > Digital Input....107

Applications > Tampering detection 107

Recording > Recording settings 108

Local storage > SD card management.... 113

Local storage > Content management 114

Appendix 117

URL Commands for the Network Camera....117

Technical Specifications 193

Technology License Notice....194

Electromagnetic Compatibility (EMC)....195

Overview

VIVOTEK FD8166 is the world's smallest network fixed dome camera. With installation as easy as one-two-three and Power over Ethernet (PoE) functionality, setup time is completed in less than 120 seconds, making installation quick and easy.

The FD8166 features a 2-Megapixel sensor enabling viewing resolution of 1920x1080 at 15 fps, and also supports the industry-standard H.264 compression technology, drastically reducing file sizes and conserving valuable network bandwidth. With MJPEG compatibility also included, video streams can also be transmitted in any of these formats for versatile applications.

Designed with selectable focal lengths, FD8166 can be used in various environments, including but not limited to offices, elevators, campus, chain stores, boutique stores and health care facilities. At the size of only 90 mm in diameter, VIVOTEK FD8166 is truly an all-in-one surveillance solution that meets a wide variety of needs for indoor surveillance. The package also includes VIVOTEK's 32-channel recording software. With all this and more, the FD8166 is the ideal solution for your surveillance needs.

Revision History

■ Rev. 1.0: Initial release

Read Before Use

The use of surveillance devices may be prohibited by law in your country. The Network Camera is not only a high-performance web-ready camera but can also be part of a flexible surveillance system. It is the user's responsibility to ensure that the operation of such devices is legal before installing this unit for its intended use.

It is important to first verify that all contents received are complete according to the Package Contents listed below. Take note of the warnings in the Quick Installation Guide before the Network Camera is installed; then carefully read and follow the instructions in the Installation chapter to avoid damage due to faulty assembly and installation. This also ensures the product is used properly as intended.

The Network Camera is a network device and its use should be straightforward for those who have basic networking knowledge. It is designed for various applications including video sharing, general security/surveillance, etc. The Configuration chapter suggests ways to best utilize the Network Camera and ensure proper operations. For creative and professional developers, the URL Commands of the Network Camera section serves as a helpful reference to customizing existing homepages or integrating with the current web server.

Package Contents

■ FD8166
■ Screws / Plastic Anchors
■ Focus adjustment tool
■ Software CD
■ Warranty Card
■ Quick Installation Guide

Symbols and Statements in this Document

Vivotek FD8166-F6 - Symbols and Statements in this Document - 1

INFORMATION: provides important messages or advices that might help prevent inconvenient or problem situations.

Vivotek FD8166-F6 - Symbols and Statements in this Document - 2

NOTE: Notices provide guidance or advices that are related to the functional integrity of the machine.

Vivotek FD8166-F6 - Symbols and Statements in this Document - 3

Tips: Tips are useful information that helps enhance or facilitae an installation, function, or process.

Vivotek FD8166-F6 - Symbols and Statements in this Document - 4

WARNING! or IMPORTANT!: These statements indicate situations that can be dangerous or hazardous to the machine or you.

Vivotek FD8166-F6 - Symbols and Statements in this Document - 5

Electrical Hazard: This statement appears when high voltage electrical hazards might occur to an operator.

Physical Description

Outer View

Leave the slide cover in place if you route cables through the bottom and then through a hole on the ceiling or wall.

Release tab Slide cover

Inner View Side View RJ-45 Socket

Lens Digital input DI+DI- Max. is 40V. LEDs MicroSD/SDHC card slot Tilt adjustment screw Reset button Screw slot

Digital Input Diagram

Please refer to the following illustration for the connection method.

Max. voltage: 40V 3.3V DI+ Digital input DI- DI-: Ground

Hardware Reset

Reset Button

The reset button is used to reset the system or restore the factory default settings. Sometimes resetting the system can return the camera to normal operation. If the system problems remain after reset, restore the factory settings and install again.

Reset: Press and release the reset button. Wait for the Network Camera to reboot.

Restore: Press and hold the recessed reset button until the status LED rapidly blinks. Note that all settings will be restored to factory default. Upon successful restore, the status LED will blink green and red during normal operation.

Micro SD/SDHC Card Capacity

This network camera is compliant with Micro SD/SDHC 32GB / 16GB / 8GB and other preceding standard SD cards.

Installation

Removing Dome Cover

  1. Use one hand to hold the camera bottom and another hand to hold the dome cover. Press the release button.
  2. Remove the dome cover.
  3. Remove the slide cover if you want to route cables from the side of camera instead of a hole on the ceiling or wall.

Camera hold the button. I want to camera or wall. Semi-circular cut-out Slide cover ① ② Release tab

Vivotek FD8166-F6 - Removing Dome Cover - 2

IMPORTANT!

  1. Record the MAC address before installing the camera.

Network Camera VIVO TEK Model No:FD8166-F2 MAC:0002D10766AD Ce FC XXXXX RoHS V©I Made in Taiwan Pat.6, 930, 709

  1. You can check the model name suffix for the type of lens mounted on your camera. The applicable lens can be:

F2: 2.5mm; F3: 3.6mm; F6: 6mm; F8: 8mm; F12: 12mm. The shorter the focal length, the wider the view.

Vivotek FD8166-F6 - IMPORTANT! - 2

NOTE:

It is recommended to use an Ethernet cable that comes without the strain relief boot. You can remove the boot if your cable comes with one.

Strain relief boot

Mounting the Network Camera - Ceiling or Wall Mount

  1. Use the curved slots on the camera as a template to mark where holes will be drilled on the ceiling. Drill two holes into the ceiling; and hammer in the plastic anchors.
  2. Drill another hole if you want to route cables through the ceiling or wall.
  3. Connect and route an Ethernet cable through the ceiling or wall.
  4. Attach the Network Camera to the ceiling using two included screws.

Routing hole position 1 2 3 4

Vivotek FD8166-F6 - Mounting the Network Camera - Ceiling or Wall Mount - 2

NOTE:

Vivotek FD8166-F6 - NOTE: - 1

natural_image Diagram of a cable or connector with a connector inserted into a housing, showing internal components and flow direction (no text or symbols)
  1. Do not completely tighten the mounting screws in the screw slots yet. You may need to turn the camera left or right for a best shooting direction later.
  2. The camera can only be powered by PoE. There is no DC or AC input connector.
  3. As shown on the left, you may also route cable from the side.

LED Definitions

ItemLED Status Description
1 Steady Red Power on and system boot-ing
2 Steady Red + blinking Green every 1 sec. (Green LED on for 1 sec and off for another)Network heartbeat
3 Blinking Red every 0.15 sec. + Blinking Green every 1 sec.(Red LED on for 0.15 sec. and Green LED on for 1 sec. and off for another)Upgrading firmware
4 Blinking Red every 0.15 sec. + blinking Green every 0.15 sec.Restoring defaults

Network Deployment

General Connection (without PoE)

Power over Ethernet (PoE)

When using a PoE-enabled switch

This Network Camera is PoE-compliant, allowing transmission of power and data via a single Ethernet cable. Follow the below illustration to connect the camera to a PoE-enabled switch via Ethernet cable.

PoE Switch

When using a non-PoE switch

Use a PoE power injector (optional) to connect between the Network Camera and a non-PoE switch.

PoE Power Injector (optional) Non-PoE Switch

Internet connection via a router

Before setting up the Network Camera over the Internet, make sure you have a router and follow the steps below.

  1. Connect your Network Camera behind a router, the Internet environment is illustrated below. Regarding how to obtain your IP address, please refer to Software Installation on page 12 for details.

Vivotek FD8166-F6 - Internet connection via a router - 1

flowchart
graph TD
    A["Internet"] --> B["Cable or DSL Modem"]
    B --> C["WAN (Wide Area Network) Router IP address: from ISP"]
    C --> D["LAN (Local Area Network) Router IP address: 192.168.0.1"]
    D --> E["IP address: 192.168.0.3\nSubnet mask: 255.255.255.0\nDefault router: 192.168.0.1"]
    D --> F["IP address: 192.168.0.2\nSubnet mask: 255.255.255.0\nDefault router: 192.168.0.1"]
  1. In this case, if the Local Area Network (LAN) IP address of your Network Camera is 192.168.0.3, please forward the following ports for the Network Camera on the router.

■ HTTP port: default is 80
■ RTSP port: default is 554
■ RTP port for audio: default is 5558
■ RTCP port for audio: default is 5559
■ RTP port for video: default is 5556
■ RTCP port for video: default is 5557

If you have changed the port numbers on the Network page, please open the ports accordingly on your router. For information on how to forward ports on the router, please refer to your router's user's manual.

  1. Find out the public IP address of your router provided by your ISP (Internet Service Provider). Use the public IP and the secondary HTTP port to access the Network Camera from the Internet. Please refer to Network Type on page 56 for details.

Internet connection with static IP

Choose this connection type if you are required to use a static IP for the Network Camera. Please refer to LAN setting on page 56 for details.

Internet connection via PPPoE (Point-to-Point over Ethernet)

Choose this connection type if you are connected to the Internet via a DSL Line. Please refer to PPPoE on page 57 for details.

Software Installation

Installation Wizard 2 (IW2), free-bundled software included on the product CD, helps you set up your Network Camera on the LAN.

  1. Install IW2 under the Software Utility directory from the software CD. Double-click the IW2 shortcut on your desktop to launch the program.

Vivotek FD8166-F6 - Software Installation - 1

  1. The program will conduct an analysis of your network environment. After your network environment is analyzed, please click Next to continue the program.

Installation Wizard 2 - Network Environment Analysis Installation Wizard 2 The wizard is analyzing your network environment. Please wait a moment. Exit Cancel Installation Wizard 2 - Network Type Installation Wizard 2 Your network environment was analyzed as below. Private DHCP Cable/DSL modem Router IP Camera PC Exit Cancel

  1. The program will search for all VIVOTEK network devices on the same LAN.
  2. After a brief search, the installer window will prompt. Click on the MAC and model name that matches the one printed on the product label. You can then double-click on the address to open a management session with the Network Camera.

Network Camera VIVO TEK Model No:FD8166-F2 MAC:0002D10766AD RoHS CE FC XXXX Pat.6, 930, 709 Made in Taiwan

Installation Wizard 2 Device Selection Select a device to setup or upgrade MAC Address Model 00-02-D1-73-02-02 192.168.5.151 FD8166 0002D1730202 Please click the MAC and model name in the product label of your device first. Then, you can start to link to your device and show the main screen by double clicking the item in the above selection list. If you are not able to find your device in the above selection list, please make sure all cables are properly connected to your device and then click on the "Refresh Devices" button. Network Camera FROM NO: P51132 0560 (T) MAC 0002D1XXXXXX You can find the product label in the rear/bottom part of your device.

Ready to Use

  1. A browser session with the Network Camera should prompt as shown below.
  2. You should be able to see live video from your camera. You may also install the 32-channel recording software from the software CD in a deployment consisting of multiple cameras. For its installation details, please refer to its related documents.

VIVOTEK Video stream: 1 Manual triggers. 1 On 2 On 3 On Pan: Stop Panel Pan speed: 0 Tilt speed: 0 Zoom speed: 0 Global view: Move Instantly Mega-Pixel Network Camera Home Client settings Configuration Language (TCP-AV) 2017/07/12 11:43:54 Go to - Select one - Powered by 3VIVOTEK

Adjusting the Lens

Vivotek FD8166-F6 - Adjusting the Lens - 1

WARNING!

Do not use your hands to tune the lens module's tilt angle. Doing so will damage the delicate tilt mechanism.

Diagram showing a hand adjusting a mechanical device with a prohibition symbol above, indicating no protection or disapproval.

Lens UP Lens DOWN

  1. Tighten the camera's mounting screws after you change the horizontal shooting direction.

  2. There is a tilt adjustment screw near the lens module. Use a #0, #1, or #2 Phillips screwdriver to turn the screw and the lens will move upwards or downwards.

  3. You may also tune the camera's horizontal orientation by turning it along its curved screw slots.

25° 25° 57°

Vivotek FD8166-F6 - WARNING! - 4

natural_image Technical line drawing of a mechanical component with no visible text or symbols
  1. With a live video feed, you can place the included focus adjustment tool carefully on the lens, and use it to turn the lens clockwise or counterclockwise to adjust to the best image focus.

You may try tuning the focus slightly closer due to the concern that focus might be changed when the dome cover is installed.

Vivotek FD8166-F6 - WARNING! - 5

natural_image Diagram of a circular mechanical component with three curved arrows indicating rotational motion (no text or symbols)
  1. Use a piece of clean cotton cloth to hold and and install the dome cover.

  2. Install dome cover by aligning the semi-circular cut-out with the release tab. Press on both ends of the dome cover for it to snap into place. A "Click" sound should be heard when it is properly installed.

6. Ins cut of "C ins Release tab Semi-circular cut-out

Accessing the Network Camera

This chapter explains how to access the Network Camera through web browsers, RTSP players, 3GPP-compatible mobile devices, and VIVOTEK recording software.

Using Web Browsers

Use Installation Wizard 2 (IW2) to access the Network Cameras on LAN.

If your network environment is not a LAN, follow these steps to access the Network Camera:

  1. Launch your web browser (e.g., Microsoft® Internet Explorer, Mozilla Firefox, or Netscape).
  2. Enter the IP address of the Network Camera in the address field. Press Enter.
  3. The live video will be displayed in your web browser.
  4. If it is the first time installing the VIVOTEK network camera, an information bar will pop up as shown below. Follow the instructions to install the required plug-in on your computer.

VIVO-TEK Mega-Pixel Network Camera This is a plugin-in (admin), if you have this load, your custom to get support or disable it. Please call. Information Help Did you notice the Information Help? The information for this tool is presented in a version of the software, but you can be able to use the system to access your own network. You can also use the system to access your own network. You can also use the system to access your own network. You can also use the system to access your own network. You can also use the system to access your own network. You can also use the system to access your own network. You can also use the system to access your own network. You can also use the system to access your own network. You can also use the system to access your own network. You can also use the system for the same user. You can also use the system to access your own network. You can also use the system to access your own network. You can also use the system to access your own network. You can also use the system to access your own network. You can also use the system to access your own network. You can also use the system to access your own network. You can also use the system to access your own network. You can also use the system to access your own network. You can also use it. You can also use the system to access your own network. You can also use the system to access your own network. You can also use the system to access your own network. You can also use the system to access your own network. You can also use the system to access your own network. You can also use the system to access your own network. You can also use the system to access your own network. You can also use the system to access your own network. You can only use the system to access your own network. You can only use the system to access your own network. You can only use the system to access your own network. You can only use the system to access your own network. You can only use the system to access your own network. You can only use the system to access your own network. You can only use the system to access your own network. You can only use the system to access your own network. You can only use the system for the same user. You can also use the system to access your own network. You can only use the system to access your own network. You can only use the system to access your own network. You can only use the system to access your own network. You can only use the system to access your own network. You can only use the system to access your own network. You can only use the system to access your own network. You can only use the system to access your own network. You can only use it. You can also use the system to access your own network. You can only use the system to access your own network. You can only use the system to access your own network. You can only use the system to access your own network. You can only use the system to access your own network. You can only use the system to access your own network. You can only use it. You can also use the system to access your own network. You can only use the system to access your own network. you can only use it. You can also use the system to access your own network. You can only use it. You can also use the system to access your own network. You can only use it. You can also use the system to access your own network. You can only use it. You can also use the system to access your own network. You can only use it. You can also use the system to access your own network. You can only use it. You can also use the system to access your own network. You can only use it. You can also use it. You can also use the system to access your own network. You can only use it. You can also use the system to access your own network. You can only use it. You can also use the system to access your own network. You can only use it. You can also use the system to access your own network. You can only use it. You can also use the system to access your own network. You can only use it. You can also use the system for a new user. You can also use the system for a new user. You can also use the system for a new user. You can also use the system for a new user. You can also use the system for a new user. You can also use the system for a new user. You can also use the system for a new user. You can also use the system for a new user. You can also use the system for a new user. You can also use the system for a new user.

VIVO-TEK Mega-Pixel Network Camera Available Mega-Scanets For Existing Image version available: □ Active Scanset This is designed to install a new file in the Web design. New items found from this image. Next > Cancel

Vivotek FD8166-F6 - Using Web Browsers - 3

NOTE:

For Mozilla Firefox or Netscape users, your browser will use Quick Time to stream the live video. If you don't have Quick Time on your computer, please download it first, then launch the web browser.

VIVOTEK Mega-Pixel Network Camera

Network Camera - Netto, Testing VIVOTEK Mega-Pixel Network Camera File Edit View Insert View Help Show the link to create the network Connection: Make for any action Save

▶ By default, the Network Camera is not password-protected. To prevent unauthorized access, it is highly recommended to set a password for the Network Camera.

For more information about how to enable password protection, please refer to Security on page 73.

If you see a dialog box indicating that your security settings prohibit running ActiveX Controls, please enable the ActiveX ^ Controls for your browser.

  1. Choose Tools > Internet Options > Security > Custom Level.

Internet Options General Security Privacy Content Connections Programs Advanced Select a Web content zone to specify its security settings. Internet Local intranet Trusted sites Restricted sites Internet This zone contains all Web sites you haven't placed in other zones Sites... Security level for this zone Custom Custom settings. - To change the settings, click Custom Level. - To use the recommended settings, click Default Level. Custom Level... Default Level OK Cancel Apply

  1. Look for Download signed ActiveX® controls; select Enable or Prompt. Click OK.

Security Settings Settings: ActiveX controls and plug-ins Download signed ActiveX controls Disable Enable Prompt Download unsigned ActiveX controls Disable Enable Prompt Initialize and script ActiveX controls not marked as safe Disable Enable Prompt Reset custom settings Reset to: Medium Reset OK Cancel

  1. Refresh your web browser, then install the ActiveXcontrol. Follow the instructions to complete installation.

Vivotek FD8166-F6 - NOTE: - 5

IMPORTANT!

  • Currently the Network Camera utilizes 32-bit ActiveX plugin. You CAN NOT open a management/view session with the camera using a 64-bit IE browser.
  • If you encounter this problem, try execute the lexlore.exe program from C:\Windows\SysWOW64. A 32-bit version of IE browser will be installed.
  • On Windows 7, the 32-bit explorer browser can be accessed from here:

C:\Program Files (x86)\Internet Explorer\iexplore.exe

- If you open a web session from the IW2 utility, a 32-bit IE browser will be opened.

Vivotek FD8166-F6 - IMPORTANT! - 1

Tips

- The onscreen Java control can malfunction under the following situations: A PC connects to different cameras that are using the same IP address (or the same camera running different firmware versions). Removing your browser cookies will solve this problem.

Using RTSP Players

To view the MPEG-4 streaming media using RTSP players, you can use one of the following players that support RTSP streaming.

Vivotek FD8166-F6 - Using RTSP Players - 1

Quick Time Player

VLC Player

  1. Launch the RTSP player.
  2. Choose File > Open URL. A URL dialog box will pop up.
  3. The address format is rtsp://:/

As most ISPs and players only allow RTSP streaming through port number 554, please set the RTSP port to 554. For more information, please refer to RTSP Streaming on page 64.

For example:

Open URL Enter an Internet URL to open: risp://192.168.5.151:554/live.sdp OK Cancel

  1. The live video will be displayed in your player.

For more information on how to configure the RTSP access name, please refer to RTSP Streaming on page 64 for details.

Vivotek FD8166-F6 - Using RTSP Players - 3

natural_image Interior view of a modern living room with wooden flooring, armchairs, and large windows (no visible text or symbols)

Vivotek FD8166-F6 - Using RTSP Players - 4

NOTE:

Quick Time player only supports playback of H.264 stream, and not the MJPEG stream. In terms of audio codec, Quick Time only supports AAC. Since this camera supports G.711 codec, audio is not available on Quick Time.

VLC player supports H.264/MPEG-4/MJPEG, and all audio codecs supported by all VIVOTEK's cameras.

Using 3GPP-compatible Mobile Devices

To view the streaming media through 3GPP-compatible mobile devices, make sure the Network Camera can be accessed over the Internet. For more information on how to set up the Network Camera over the Internet, please refer to Setup the Network Camera over the Internet on page 10.

To utilize this feature, please check the following settings on your Network Camera:

  1. Because most players on 3GPP mobile phones do not support RTSP authentication, make sure the authentication mode of RTSP streaming is set to disable.
    For more information, please refer to RTSP Streaming on page 64.

  2. As the bandwidth on 3G networks is limited, you will not be able to use a large video size. Please set the video and audio streaming parameters as listed below.

For more information, please refer to Stream settings on page 50.

Video Mode MPEG-4
Frame size 176 x 144
Maximum frame rate 5 fps
Intra frame period 1S
Video quality (Constant bit rate) 40kbps
Audio type (GSM-AMR) 12.2kbps
  1. As most ISPs and players only allow RTSP streaming through port number 554, please set the RTSP port to 554. For more information, please refer to RTSP Streaming on page 64.

  2. Launch the player on the 3GPP-compatible mobile devices (e.g., Real Player).

  3. Type the following URL commands into the player.

The address format is rtsp://:/.

For example:

Open URL Enter an Internet URL to open: rsp://192.168.4.147:554/live2.sdp OK Cancel

You can configure Stream #2 into the suggested stream settings as listed above for live viewing on a mobile device.

Using VIVOTEK Recording Software

The product software CD also contains an ST7501 recording software, allowing simultaneous monitoring and video recording for multiple Network Cameras. Please install the recording software; then launch the program to add the Network Camera to the Channel list. For detailed information about how to use the recording software, please refer to the user's manual of the software or download it from http://www.vivotek.com.

VIVOTEK System Edit View Configuration Layout Help VYTK_SN091327 0.0.13 Camera 1_P7761(192,168.3,156) 2_P7761(292,168.3,156) 3_P7761(192,168.3,156) 4_P7761(292,168.3,152) HD/132 HD/141 P27132 IP7160 Control room Corder Highway ED/130 ED/141 Forkhead Stations Hall Platforms Maintenance Duckwall Toupts Factory S408111 EP7764 IP7751 IP7151 IP7152 IP7151 IP7150 IP7150 IP7150 IP7150 IP7150 IP7150 IP7150 IP7150 IP7150 IP7150 IP7150 IP7150 IP7150 IP7150 IP7150 IP7150 IP7150 IP7733 IP7751 IP7752 IP7752 IP7752 IP7752 IP7752 IP7752 IP7752 IP7752 IP7752 IP7752 IP7752 IP7752 IP7752 IP7752 IP7752 IP7752 IP7752 IP7133 IP7133 IP7133 IP7133 IP7133 IP7133 IP7133 IP7133 IP7133 IP7133 IP7133 IP7133 IP7133 IP7133 IP7133 IP7133 IP7133 IP76122v SP66666v Parking Coeller School

Main Page

This chapter explains the layout of the main page. It is composed of the following sections: VIVOTEK INC. Logo, Host Name, Camera Control Area, Configuration Area, Menu, and Live Video Window.

VIVOTEK INC. Logo Resize Buttons VIVOTEK Video dream: Manual tropers Camera Control Area Fan speed 1x speed Zoom speed Global view Hide Button Mega-Pixel Network Camera Host Name Mission Card settings Configuration Language Configuration Area Live View Window Go to Save User

Click this logo to visit the VIVOTEK website.

Host Name

The host name can be customized to fit your needs. For more information, please refer to System on page 32.

Camera Control Area

Video Stream: This Network Camera supports multiple streams (stream 1 \~ 2) simultaneously. You can select either one for live viewing. For more information about multiple streams, please refer to page 81 for detailed information.

Manual Trigger: Click to enable/disable an event trigger manually. Please configure an event setting on Application page before enable this function. A total of 3 event settings can be configured. For more information about event setting, please refer to page 90. If you want to hide this item on the homepage, please go to Configuration> System > Homepage Layout > General settings > Customized button to deselect "show manual trigger button".

Configuration Area

Client Settings: Click this button to access the client setting page. For more information, please refer to Client Settings on page 27.

Configuration: Click this button to access the configuration page of the Network Camera. It is suggested that a password be applied to the Network Camera so that only the administrator can configure the Network Camera. For more information, please refer to Configuration on page 31.

Language: Click this button to choose a language for the user interface. Language options are available in: English, Deutsch, Español, Français, Italiano, 日本語, Português, 簡体中文, and 繁體中文. Please note that you can also change a language on the Configuration page; please refer to page 31.

Hide Button

You can click the hide button to hide the control panel or display the control panel.

Resize Buttons

Vivotek FD8166-F6 - Resize Buttons - 1

Click the Auto button, the video cell will resize automatically to fit the monitor. Click 100% is to display the original homepage size. Click 50% is to resize the homepage to 50% of its original size. Click 25% is to resize the homepage to 25% of its original size.

Live Video Window

■ The following window is displayed when the video mode is set to H.264 / MPEG-4:

H.264 / MPEG-4 Protocol and Media Options Video Title Title and Time Zoom Indicator x4.0 Video (TPC-AV) 2011/02/25 17:08:56 Time Video 17:08:56 2011/06/25 Go to Select one Video and Audio Control Buttons

Video Title: The video title can be configured. For more information, please refer to Video Settings on page 50.

H.264 / MPEG-4 Protocol and Media Options: The transmission protocol and media options for H.264 / MPEG-4 video streaming. For further configuration, please refer to Client Settings on page 27.

Time: Display the current time. For further configuration, please refer to Media > Image > Genral settings on page 44.

Title and Time: The video title and time can be stamped on the streaming video. For further configuration, please refer to Media > Image > General settings on page 44.

Global View: Click on this item to display the Global View window. The Global View window contains a full view image (the largest frame size of the captured video) and a floating frame (the viewing region of the current video stream). The floating frame allows users to control the e-PTZ function (Electronic Pan/Tilt/Zoom). For more information about e-PTZ operation, please refer to E-PTZ Operation on page 87. For more information about how to set up the viewing region of the current video stream, please refer to page 87.

Global View: The viewing region of the current video stream The largest frame size Moving Instantly

PTZ Panel: This Network Camera supports both "digital" (e-PTZ) pan/tilt/zoom control. Please refer to PTZ settings on page 87 for detailed information.

Video and Audio Control Buttons: Depending on the Network Camera model and Network Camera configuration, some buttons may not be available.

Snapshot: Click this button to capture and save still images. The captured images will be displayed in a pop-up window. Right-click the image and choose Save Picture As to save it in JPEG (*.jpg) or BMP (*.bmp) format.

Digital Zoom: Click and uncheck "Disable digital zoom" to enable the zoom operation. The navigation screen indicates the part of the image being magnified. To control the zoom level, drag the slider bar. To move to a different area you want to magnify, drag the navigation screen.

Disable digital ptz Zoom Factor: 100% 100% 400%

Pause: Pause the transmission of the streaming media. The button becomes the ▶ Resume button after clicking the Pause button.

Stop: Stop the transmission of the streaming media. Click the Resume button to continue transmission.

- Start MP4 Recording: Click this button to record video clips in MP4 file format to your computer. Press the - Stop MP4 Recording button to end recording. When you exit the web browser, video recording stops accordingly. To specify the storage destination and file name, please refer to MP4 Saving Options on page 28 for details.

Volume: When the Mute function is not activated, move the slider bar to adjust the volume on the local computer.

Mute: Turn off the volume on the local computer. The button becomes the Audio On button after clicking the Mute button.

Full Screen: Click this button to switch to full screen mode. Press the "Esc" key to switch back to normal mode.

■ The following window is displayed when the video mode is set to MJPEG:

Video Title Title and Time Video (HTTP-V) 2011/02/25 17:08:56 Video 17:08:56 2011/06/25 Time Video Control Buttons

Video Title: The video title can be configured. For more information, please refer to Media > Image on page 44.

Time: Display the current time. For more information, please refer to Media > Image on page 44.

Title and Time: Video title and time can be stamped on the streaming video. For more information, please refer to Media > Image on page 44.

Video and Audio Control Buttons: Depending on the Network Camera model and Network Camera configuration, some buttons may not be available.

Snapshot: Click this button to capture and save still images. The captured images will be displayed in a pop-up window. Right-click the image and choose Save Picture As to save it in JPEG (*.jpg) or BMP (*.bmp) format.

Digital Zoom: Click and uncheck "Disable digital zoom" to enable the zoom operation. The navigation screen indicates the part of the image being magnified. To control the zoom level, drag the slider bar. To move to a different area you want to magnify, drag the navigation screen.

Disable digital ptz Zoom Factor: 100% 100% 400%

Start MP4 Recording: Click this button to record video clips in MP4 file format to your computer. Press the Stop MP4 Recording button to end recording. When you exit the web browser, video recording stops accordingly. To specify the storage destination and file name, please refer to MP4 Saving Options on page 28 for details.

Full Screen: Click this button to switch to full screen mode. Press the "Esc" key to switch back to normal mode.

Go to

If you configured and chose to display a smaller region of interest from out of a maximum image frame, you can configure different areas within the frame as preset points, and use this menu to move to a location.

Go to — Select one — — Select one — upper upper left lower left center upper right right lower right

A zoom indicator will be displayed on the Home page when you zoom in/out on the live viewing window as shown below. You may zoom in/out on the image by scrolling the mouse wheel inside the live viewing window, and the maximum zoom in will be up to 4 times.

Video Title Title and Time Video TCP-AV 2012/11/09 17:08:56 Video 17:08:56 2012/11/09 Zoom Factor X2.1 Zoom In Zoom Out

Client Settings

This chapter explains how to select the stream transmission mode and saving options on the local computer. When completed with the settings on this page, click Save on the page bottom to enable the settings.

H.264 Media Options

H.264 Media Options

Video and Audio
Video Only
Audio Only

Select to stream video or audio data or both. This is enabled only when the video mode is set to H.264.

H.264 Protocol Options

H.264 Protocol Options

○ UDP Unicast
○ UDP Multicast
TCP
HTTP

Depending on your network environment, there are four transmission modes of H.264 streaming:

UDP unicast: This protocol allows for more real-time audio and video streams. However, network packets may be lost due to network burst traffic and images may be broken. Activate UDP connection when occasions require time-sensitive responses and the video quality is less important. Note that each unicast client connecting to the server takes up additional bandwidth and the Network Camera allows up to ten simultaneous accesses.
UDP multicast: This protocol allows multicast-enabled routers to forward network packets to all clients requesting streaming media. This helps to reduce the network transmission load of the Network Camera while serving multiple clients at the same time. Note that to utilize this feature, the Network Camera must be configured to enable multicast streaming at the same time. For more information, please refer to RTSP Streaming on page 64.
TCP: This protocol guarantees the complete delivery of streaming data and thus provides better video quality. The downside of this protocol is that its real-time effect is not as good as that of the UDP protocol.
HTTP: This protocol allows the same quality as TCP protocol without needing to open specific ports for streaming under some network environments. Users inside a firewall can utilize this protocol to allow streaming data through.

MP4 Saving Options

MP4 saving options

Folder:

D:\Record

Browse...

File name prefix:

CLIP

Vivotek FD8166-F6 - MP4 saving options - 1

Add date and time suffix to file name

Users can record live video as they are watching it by clicking Start MP4 Recording on the main page. Here you can specify the storage destination and file name.

Folder: Specify a storage destination for the recorded video files.

File name prefix: Enter the text that will be appended to the front of the video file name.

Add date and time suffix to the file name: Select this option to append the date and time to the end of the file name.

CLIP_20110628-180853

Vivotek FD8166-F6 - MP4 saving options - 2

Vivotek FD8166-F6 - MP4 saving options - 3

File name prefix

Date and time suffix

The format is: YYYYMMDD_HHMMSS

Local Streaming Buffer Time

Local streaming buffer time

Vivotek FD8166-F6 - Local Streaming Buffer Time - 1

Millisecond

Save

Due to the unsteady bandwidth flow, the live streaming may lag and not be very smoothly. If you enable this option, the live streaming will be stored on the cache memory of the PC having a web session with the camera for a few seconds before being played on the live viewing window. This helps you see the streaming more smoothly. If you enter 3000 Millisecond, the streaming will delay for 3 seconds.

Joystick settings

Enable Joystick

Connect a joystick to a USB port on your management computer. Supported by the plug-in (Microsoft's DirectX), once the plug-in for the web console is loaded, it will automatically detect if there is any joystick on the computer. The joystick should work properly without installing any other driver or software.

Then you can begin to configure the joystick settings of connected devices. Please follow the instructions below to enable joystick settings.

  1. Select a detected joystick, if there are multiple, from the Selected joystick menu. If your joystick is not detected, if may be defective.
  2. Click Calibrate or Configure buttons to configure the joystick-related settings.

Joystick settings Selected joystick: Macally AirStick Calibrate Configure buttons Save

Vivotek FD8166-F6 - Enable Joystick - 2

NOTE:

  • If you want to assign Preset actions to your joystick, the preset locations should be configured in advance in the Configuration > PTZ page.
  • If your joystick is not working properly, it may need to be calibrated. Click the Calibrate button to open the Game Controllers window located in Microsoft Windows control panel and follow the instructions for trouble shooting.
  • The joystick will appear in the Game Controllers list in the Windows Control panel. If you want to check out for your devices, go to the following page: Start -> Control Panel -> Game Controllers.

Game Controllers These settings help you configure the game controllers installed on your computer. Installed game controllers Controller Status CH PRODUCTS IP DESKTOP CONTROLLER OK Add... Remove Properties Advanced... Troubleshoot... OK

Buttons Configuration

Click the Configure Buttons button, a window will prompt as shown below. Please follow the steps below to configure your joystick buttons:

  1. Select a button number from the Button # pull-down menu.

>Joystick Settings Actions: Toggle play/pause Button: 1 1 2 3 4 5 6 7 8 9 10 11 12 Assigned Actions Full Screen Stop Zoom in Patrol Toggle play/pause Snapshot Assign Delete OK 網際網路 | 受保議模式: 關閉 100%

Vivotek FD8166-F6 - Buttons Configuration - 2

Tips

If you are not sure of the locations of each button, use the Properties window in the Game Controllers utility.

Configure Settings 12.0 These settings help you configure the game controller installed on your computer. Installed game controller: Configure Status Macally ACNLS OK Add... Remove Properties Advanced... Troubstruct... OK Find any key components Settings Text Text for game controller. If there is more information in which functioning properly, I may need to be calculated. To calculate it, go to the Settings page. Auto: 10/45/71 Auto: 146 Buttons: 1 2 3 4 5 6 7 8 9 10 11 12 OK Cancel Help

  1. Select a corresponding action, such as Patrol or Preset#.

>Joystick Settings Actions: Toggle play/pause Toggle play/pause Stop streaming Snapshot Full Screen Start/stop recording Pan Patrol Stop Zoom in Zoom out Digital output on/off 1 Digital output on/off 2 Digital output on/off 3 Digital output on/off 4 Manual trigger on/off 1 Manual trigger on/off 2 Manual trigger on/off 3 Preset 1 Preset 2 Preset 3 Preset 4 Preset 5 Preset 6 Preset 7 Preset 8 Preset 9 Preset 10 Preset 11 Preset 12 Preset 13 Assign Delete OK

  1. Click the Assign button to assign an action to the button. You can delete an association by selecting a button number, and then click the Delete button.

Repeat the process until you are done with the configuration of all preferred actions.

The buttons you define should appear on the button list accordingly.

  1. Please remember to click the Save button on the Client settings page to preserver your settings.

Configuration

Click Configuration on the main page to enter the camera setting pages. Note that only Administrators can access the configuration page.

VIVOTEK offers an easy-to-use user interface that helps you set up your network camera with minimal effort. To simplify the setting procedure, two types of user interfaces are available: Advanced Mode for professional users and Basic Mode for entry-level users. Some advanced functions (PTZ/ Event/ Recording/ Local storage) are not displayed in Basic Mode.

If you want to set up advanced functions, please click [Advanced Mode] on the bottom of the configuration list to quickly switch to Advanced Mode.

In order to simplify the user interface, the detailed information will be hidden unless you click to unfold a functional item. When you click on the first sub-item, the detailed information for the first sub-item will be displayed; when you click on the second sub-item, the detailed information for the second sub-item will be displayed and that of the first sub-item will be hidden.

The following is the interface of the Basic Mode and the Advanced Mode:

Basic Mode

VIVOTEK www.vivotek.com Home Client settings Configuration Language System > General settings System Navigation Area General settings Maintenance Host name: Mega-Pixel Network Camera □ Turn off the LED indicator Media Network Security Applications Configuration List System time ● Keep current date and time ○ Synchronize with computer time ○ Manual ○ Automatic Click to switch to Advanced Mode Save [ Advanced mode ] Version: 0100d0 Firmware Version

Advanced Mode

VIVOTEK Home Client settings Configuration Language System > General settings System General settings Homepage layout Logs Parameters Maintenance Media Network Security PTZ Event Applications Recording Local storage [ Basic mode ] Version: 010046 Navigation Area Host name: Mega-Pixel Network Camera Turn off the LED indicator System time Time zone: GMT+08.00 Beijing, Chongqing, Hong Kong, Kuala Lumpur, Singapore, Taipei Note: You can upload your daylight saving time rules on Maintenance page or use the camera default value. Keep current date and time Synchronize with computer time Manual Automatic Configuration List Click to switch to Basic Mode Firmware Version

Each function on the configuration list will be explained in the following sections. Those functions that are displayed only in Advanced Mode are marked with Advanced Mode. If you want to set up advanced functions, please click [Advanced Mode] on the bottom of the configuration list to quickly switch over.

The Navigation Area provides access to the Home page (the monitoring page for live viewing), Client settings, Configuration page, and multi-language selection.

System > General settings

This section explains how to configure the basic settings for the Network Camera, such as the host name and system time. It is composed of the following two columns: System, and System Time. When finished with the settings on this page, click Save at the bottom of the page to enable the settings.

System

System Host name: Mega-Pixel Network Camera Turn off the LED indicator

Host name: Enter a desired name for the Network Camera. The text will be displayed at the top of the main page, and also on the view cell of ST7501 and VAST management software.

Turn off the LED indicators: If you do not want others to notice the network camera is in operation, you can select this option to turn off the LED indicators.

System time

System time Time zone: GMT+08:00 Beijing, Chongqing, Hong Kong, Kuala Lumpur, Singapore, Taipei Note: You can upload your daylight saving time rules on Maintenance page or use the camera default value. Keep current date and time Synchronize with computer time Manual Automatic Save

Keep current date and time: Select this option to preserve the current date and time of the Network Camera. The Network Camera's internal real-time clock maintains the date and time even when the power of the system is turned off.

Synchronize with computer time: Select this option to synchronize the date and time of the Network Camera with the local computer. The read-only date and time of the PC is displayed as updated.

Manual: The administrator can enter the date and time manually. Note that the date and time format are [yyyy/mm/dd] and [hh:mm:ss].

Automatic: The Network Time Protocol is a protocol which synchronizes computer clocks by periodically querying an NTP Server.

NTP server: Assign the IP address or domain name of the time-server. Leaving the text box blank connects the Network Camera to the default time servers.

Update interval: Select to update the time using the NTP server on an hourly, daily, weekly, or monthly basis.

Time zone Advanced Mode: Select the appropriate time zone from the list. If you want to upload Daylight Savings Time rules, please refer to System > Maintenance > Import/ Export files on page 41 for details.

System > Homepage layout Advanced Mode

This section explains how to set up your own customized homepage layout.

General settings

This column shows the settings of your homage layout. You can manually select the background and font colors in Theme Options (the second tab on this page). The settings will be displayed automatically in this Preview field. The following shows the homepage using the default settings:

General settings Theme options VIVOTEK www.vivotek.com Video stream 1 Manual triggers: Powered by VIVOTEK Mega-Pixel Network Hide Powered by VIVOTEK

■ Hide Powered by VIVOTEK: If you check this item, it will be removed from the homepage.

Logo graph

Here you can change the logo at the top of your homepage.

Logo graph A customized logo (Gif, JPG or PNG) can be uploaded for main page. It will be resized to 160x50 pixels to replace the previous logo. Default Custom VIVOTEK www.vivotek.com Browse... Upload Logo link: http://www.vivotek.com

Follow the steps below to upload a new logo:

  1. Click Custom and the Browse field will appear.
  2. Select a logo from your files.
  3. Click Upload to replace the existing logo with a new one.
  4. Enter a website link if necessary.
  5. Click Save to enable the settings.

Customized button

If you want to hide manual trigger buttons on the homepage, please uncheck this item. This item is checked by default. Customized button

Customized button ✓ Show manual trigger button Save

Theme Options

Here you can change the color of your homepage layout. There are three types of preset patterns for you to choose from. The new layout will simultaneously appear in the Preview filed. Click Save to enable the settings.

General settings Theme options VIVOTEK www.vivotek.com Mega-Pixel Network Font Color of the Video Title Video stream 1 Manual triggers: Font Color of the Control Area Background Color of the Configuration Area Background Color of the Configuration Area Powered by VIVOTEK Font Color of the Video Area Background Color of the Video Area Frame Color Preset patterns Themes Custom Color Font color: #000000 Font color of configuration area: #FFFFFFF Font color of video title: #098BD6 Bk color of control area: #C4EAFF Bk color of configuration area: #0186D1 Bk color of video area: #C4EAFF Frame color: #0186D1 Save

General settings Theme options VIVOTEK www.vivotek.com Video stream 1 Manual triggers: Powered by VIVOTEK Mega-Pixel Network General settings Theme options VIVOTEK www.vivOTEK.com Video stream 1 Manual triggers: Powered by VIVOTEK Mega-Pixel Network

■ Follow the steps below to set up the customed homepage:

  1. Click Custom on the left column.
  2. Click the field where you want to change the color on the right column.

Themes Custom Pattern Custom Color Font color: Font color of configuration area: #FFFFFFF Font color of video title: #098BD6 Bk color of control area: #565656 Bk color of configuration area: #323232 Bk color of video area: #565656 Frame color: #323232 Color Selector

  1. The palette window will pop up as shown below.

Hex: #000000 Red: 0 Green: 0 Blue: 0 Hue: 0 Saturation: 0 Value: 0 Select

Hex: #23538A Red: 35 Green: 83 Blue: 138 Hue: 212 Saturation: 74.6 Value: 54.1 4 Select

  1. Drag the slider bar and click on a spot on the left square to select a desired color.
  2. The selected color will be displayed in the corresponding fields and in the Preview column.
  3. Click Save to enable the settings.

System > Logs Advanced Mode

This section explains how to configure the Network Camera to send the system log to a remote server as backup.

Log server settings

Log server settings Enable remote log IP address: port: 514 Save

Follow the steps below to set up the remote log:

  1. Select Enable remote log.
  2. In the IP address text box, enter the IP address of the remote server.
  3. In the port text box, enter the port number of the remote server.
  4. When completed, click Save to enable the setting.

You can configure the Network Camera to send the system log file to a remote server as a log backup. Before utilizing this feature, it is suggested that the user install a log-recording tool to receive system log messages from the Network Camera. An example is Kiwi Syslog Daemon. Visit http://www.kiwisyslog.com/kiwi-syslog-daemon-overview/.

Kewi Syslog Daemon (Version 7.1.4) File View Help Display 00 [Default] Date Time Priority Hostname Message 01-12-2008 15:21:32 Users.Info 192.168.5.121 [RTSP SERVER] Stop one session, IP=192.168.5.122 01-12-2008 15:21:31 Users.info 192.168.5.121 [RTSP SERVER] Start one session, IP=192.168.5.122 01-12-2008 15:20:47 Syslog.Info 192.168.5.121 syslogd 1.4.1: restart. 100% 3 MPH 15:34 01-12-2008

System log

Jan 5 11:36.07 syslogd 1.5.0: restart. Jan 5 11:36.08 [swatchdog]: Ready to watch httpd. Jan 5 11:36.09 [EVENT MGR]: Starting eventmgr with support for EcTun Jan 5 11:36:11 [DRM Service]: Starting DRM service. Jan 5 11:36:20 [UPnPIGDCP]: Search IGD failed Jan 5 11:36:23 automount[718]: >> mount: mounting /dev/mmcblk0p1 on /mnt/auto/CF failed: No such device or address Jan 5 11:36:23 automount[718]: mount generic): failed to mount /dev/mmcblk0p1 (type vfat) on /mnt/auto/CF Jan 5 11:36:23 [IR Cut Control]: Day mode Jan 5 11:36:23 automount[728]: >> mount: mounting /dev/mmcblk0p1 on /mnt/auto/CF failed: No such device or address Jan 5 11:36:23 automount[728]: mount generic): failed to mount /dev/mmcblk0p1 (type vfat) on /mnt/auto/CF Jan 5 11:36:23 [IR Cut Control]: Day mode Jan 5 11:36:23 [SYS]: Serial number = 0002D10ED4C9 Jan 5 11:36:23 [SYS]: System starts at Wed Jan 5 11:36:23 UTC 2011

This column displays the system log in a chronological order. The system log is stored in the Network Camera's buffer area and will be overwritten when reaching a certain limit.

You can install the included ST7501 recording software, which provides an Event Management function group for delivering event messages via emails, GSM short messages, onscreen event panel, or to trigger an alarm, etc. For more information, refer to the ST7501 User Manual.

Vivotek FD8166-F6 - System log - 2

flowchart
graph TD
    A["VIVOTEK Network Cameras"] --> B["Internet"]
    B --> C["3G Cell phone"]
    B --> D["3G Cell phone Short message"]
    B --> E["GSM Modem"]
    B --> F["PC with ST7501 Recording Software"]
    B --> G["Digital output"]
    B --> H["PTZ"]
    B --> I["Email"]
    B --> J["HTTP"]
    J --> B

Access log

System log Access log

Jan 5 11:36:28 [RTSP SERVER]: Start one session, IP=172.16.2.52
Jan 5 11:49:15 [RTSP SERVER]: Start one session, IP=192.168.4.105
Jan 5 13:11:20 [RTSP SERVER]: Start one session, IP=192.168.4.105 

Access log displays the access time and IP address of all viewers (including operators and administrators) in a chronological order. The access log is stored in the Network Camera's buffer area and will be overwritten when reaching a certain limit.

System > Parameters Advanced Mode

The View Parameters page lists the entire system's parameters. If you need technical assistance, please provide the information listed on this page.

Parameters

system_hostname='Mega-Pixel Network Camera'
system_ledoff='0'
system_lowlight='1'
system_date='2013/03/11'
system_time='18:02:41'
system_datetime�'
system_ntp='
system_timezone
system_timezone
system Complaintindex='320'
system daylight_enable='0'
system daylight_dstactualmode='1'
system daylight_auto_begintime='NONE'
system daylight_auto_endtime='NONE'
system daylight_timezones=',-360,-320,-280,-240,-241,-200,-201,-160,-14
system_updateinterval='86400'
system_info_modelname='FD8166'
system_info_extendedmodelname='FD8166'
system_info_serialnumber='00D281660007'
system_info_firmwareversion='FD8166-VVTK-0100c'
system_info_language_count='9'
system_info_language_i0='English'
system_info_language_i1='Deutsch'
system_info_language_i2='Español'
system_info_language_i3='Français'
system_info_language_i4='Italiano'
system_info_language_i5='日本語'
system_info_language_i6='Português'
system_info_language_i7='简体中文'
system_info_language_i8='繁體中文' 

System > Maintenance

This chapter explains how to restore the Network Camera to factory default, upgrade firmware version, etc.

General settings > Upgrade firmware

Upgrade firmware

Select firmware file:

Browse.

Upgrade

This feature allows you to upgrade the firmware of your Network Camera. It takes a few minutes to complete the process.

Note: Do not power off the Network Camera during the upgrade!

Follow the steps below to upgrade the firmware:

  1. Download the latest firmware file from the VIVOTEK website. The file is in .pkg file format.
  2. Click Browse... and specify the firmware file.
  3. Click Upgrade. The Network Camera starts to upgrade and will reboot automatically when the upgrade completes.

If the upgrade is successful, you will see "Reboot system now!! This connection will close". After that, re-access the Network Camera.

The following message is displayed when the upgrade has succeeded.

Reboot system now!! This connection will close.

The following message is displayed when you have selected an incorrect firmware file.

Starting firmware upgrade...

Do not power down the server during the upgrade.

The server will restart automatically after the upgrade is completed.

This will take about 1 - 5 minutes.

Wrong PKG file format

Unpack fail

General settings > Reboot

Reboot

Reboot

This feature allows you to reboot the Network Camera, which takes about one minute to complete. When completed, the live video page will be displayed in your browser. The following message will be displayed during the reboot process.

The device is rebooting now. Your browser will reconnect to http://192.168.5.151:80/ If the connection fails, please manually enter the above IP address in your browser.

[Non-Text]

If the connection fails after rebooting, manually enter the IP address of the Network Camera in the address field to resume the connection.

General settings > Restore

Restore

Restore all settings to factory default except settings in

Vivotek FD8166-F6 - Restore - 1

Network

Vivotek FD8166-F6 - Restore - 2

Daylight saving time

Vivotek FD8166-F6 - Restore - 3

Custom language

Restore

This feature allows you to restore the Network Camera to factory default settings.

Network: Select this option to retain the Network Type settings (please refer to Network Type on page 56).

Daylight Saving Time: Select this option to retain the Daylight Saving Time settings (please refer to Import/Export files below on this page).

Custom Language: Select this option to retain the Custom Language settings.

If none of the options is selected, all settings will be restored to factory default. The following message is displayed during the restoring process.

The device is rebooting now. Your browser will reconnect to http://192.168.5.151:80/ If the connection fails, please manually enter the above IP address in your browser.

Vivotek FD8166-F6 - Restore - 4

Import/Export files

Advanced Mode

This feature allows you to Export / Update daylight saving time rules, custom language file, configuration file, and server status report.

General settings

Import/Export files

Export files

Export daylight saving time configuration file

Export

Export language file

Export

Export configuration file

Export

Export server status report

Export

Upload files

Update daylight saving time rules:

Browse...

Upload

Update custom language file:

Browse...

Upload

Upload configuration file:

Browse..

Upload

Export daylight saving time configuration file: Click to set the start and end time of DST (Daylight Saving).

Follow the steps below to export:

  1. In the Export files column, click Export to export the daylight saving time configuration file from the Network Camera.

  2. A file download dialog will pop up as shown below. Click Open to review the XML file or click Save to store the file for editing.

File Download Do you want to open or save this file? Name: config_dst.xml Type: XML Document, 11.1 KB From: 192.168.5.151 Open Save Cancel While files from the Internet can be useful, some files can potentially harm your computer. If you do not trust the source, do not open or save this file. What's the risk?

  1. Open the file with Microsoft ^® Notepad and locate your time zone; set the start and end time of DST. When completed, save the file.

In the example below, DST begins each year at 2:00 a.m. on the second Sunday in March and ends at 2:00 a.m. on the first Sunday in November.

First Sunday 2 60 3 Second Sunday 2 -60 11 First sunday 2

Update daylight saving time rules: Click Browse... and specify the XML file to update.

If the incorrect date and time are assigned, you will see the following warning message when uploading the file to the Network Camera.

First Sunday 2 60 15 Second Sunday 2 -60 11 First Sunday 2

Invalid value in TimeZone 1d: -240 . . .

The following message is displayed when attempting to upload an incorrect file format.

Microsoft Internet Explorer The file must have a .xml filename suffix. OK

Export language file: Click to export language strings. VIVOTEK provides nine languages: English, Deutsch, Español, Français, Italiano, 日本語, Português, 簡体中文, and 繁體中文.

Update custom language file: Click Browse... and specify your own custom language file to upload.

Export configuration file: Click to export all parameters for the device and user-defined scripts.

Update configuration file: Click Browse... to update a configuration file. Please note that the model and firmware version of the device should be the same as the configuration file. If you have set up a fixed IP or other special settings for your device, it is not suggested to update a configuration file.

Export server staus report: Click to export the current server status report, such as time, logs, parameters, process status, memory status, file system status, network status, kernel message ... and so on.

Media > Image

Advanced Mode

This section explains how to configure the image settings of the Network Camera. It is composed of the following four columns: General settings, Picture settings, Exposure, and Privacy mask.

General settings

General settings Image settings Exposure Privacy mask Video Settings Video title FD8166 ✓ Show timestamp and video title in video and snapshots: Color: B/W Color Power line frequency: 50 Hz 60 Hz Video orientation: ✓ Flip ✓ Mirror Save

Video title: Enter a name that will be displayed on the title bar of the live video as the picture shown below.

Show timestamp and video title in videos and snapshots: Select this checkbox if you prefer video title and time stamp to display in videos and snapshots.

A zoom indicator will be displayed on the Home page when you zoom in/out the live viewing window as the picture shown below. You may zoom in/out the image by scrolling the mouse wheel inside the live viewing window, and the maximum zoom in will be up to 4 times.

Video Title Title and Time Zoom Factor Video (TCP-AV) 2012/03/09 17:08:56 Video 17:08:56 2010/11/25 x1.1

Color: Select to display color or black/white video streams.

Power line frequency: Set the power line frequency consistent with local utility settings to eliminate image flickering associated with fluorescent lights. Note that after the power line frequency is changed, you must disconnect and reconnect the power cord of the Network Camera in order for the new setting to take effect.

Video orientation: Flip--vertically reflect the display of the live video; Mirror--horizontally reflect the display of the live video. Select both options if the Network Camera is installed upside-down (e.g., on the ceiling) to correct the image orientation. Please note that if you have configured preset locations, those locations will be cleared after flip/mirror setting.

Image settings

On this page, you can tune the White balance, Image adjustment, and low light compensation.

General settings Image settings Exposure Privacy mask F08166(TCPV) 2013/01/11 18:10:40 F08166(TCPV) Picture Setting 1: For normal situations White balance Auto Fix current value On Off Image adjustment Brightness: -5 Contrast: 0 Saturation: 50% Sharpness: 50% Gamma curve: Manual Default Contrast 0.45 Enable low light compensation Picture Setting 2: For special situations Profile Restore Save

White balance: Adjust the value for the best color temperature.

■ You may follow the steps below to adjust the white balance to the best color temperature.

  1. Place a sheet of paper of white or cooler-color temperature paper, such as blue, in front of the lens, then allow the Network Camera to automatically adjust the color temperature.
  2. Click the On button to Fix current value and confirm the setting while the white balance is being measured.

Image Adjustment

■ Brightness: Adjust the image brightness level, which ranges from -5 to +5.
■ Contrast: Adjust the image contrast level, which ranges from -5 to +5.
■ Saturation: Adjust the image saturation level, which ranges from 0 to 100%.

■ Sharpness: Adjust the image sharpness level, which ranges from 0 to 100%. You can also select Customize and manually enter a value.

■ Gamma curve: Adjust the image sharpness level, which ranges from 0.45 to 1.0. You may let firmware Optimize your display or select a value to change the preferred level of Gamma correction towards higher contrast or towards the higher luminance for detailed expression for both dark and lighted areas of an image.

■ Enable low light compensation: Select this option in low light mode, and the values of sharpness and brightness will change automatically as the firmware exerts an automated noise reduction. In low light mode, system will increase input gains, and as a side effect, noises will also increase. This function reduces the noises in images taken in low light scenarios.

You can click Restore to recall the original settings without incorporating the changes. When completed with the settings on this page, click Save to enable the setting. You can also click on Profile to adjust all settings above in a pop-up window for special lighting conditions for during a specific period of time in a day.

Activated period: Select the period of time this profile setting will apply to. Please manually enter a range of time in a day, tune the White Balance and Image adjustment settings as previously described, and then check Save for the configuration to take effect.

Profile of image settings FD8166(TCP-V) 2013/9/12 08:59:07 Activated period Enable and apply this profile to: White balance Auto Fix current value: On Off Image adjustment Brightness: -5 Contrast: 0 Saturation: 50% Sharpness: 50% Gamma curve: Optimize Enable low light compensation Restore Save Close

Exposure Advanced Mode

On this page, you can set the Measurement window, Exposure level, Exposure time, and Gain control settings. Detailed configurations will be automatically adjusted since the sensor library will automatically adjust the value according to the ambient light.

Sensor Setting 1: For normal situations

Measurement window Full view BLC Exposure control Exposure level: 4 Flickless Exposure time: 1/32000 - 1/120 Gain control: 0 - 49 % Profile Restore Save ng 2: situations

Sensor Setting 2: For special situations

Measurement Window: This function allows user to set measurement window(s) for low light compensation.

■ Full view: Calculate the full range of view and offer appropriate light compensation.

■ BLC (Back Light Compensation): This option allows you to use the center of the current view as the measuring area. The measuring window refers to "weighted window" where the lighting condition within the particular area is taken into account. Camera firmware then adopts the weighted averages method to calculate the value and provides necessary light compensation.

General settings Picture settings Exposure Privacy mask F:\Users\TCP-VI 2000/11 13:52:54 BLC Measurement window ● Full view ○ BLC Exposure control Exposure level: 4 ● Flickless Exposure time: 18000 - 1/480 Gain control: 34 - 62 % Profile Restore Save

Exposure control:

■ Exposure level: You can manually set the Exposure level, which ranges from 0 to 8 (dark to bright).

■ Flickerless: This function helps avoid the flickering on images because of the fast shutter movement and the inconsistency between power line frequency and exposure time. When selected, the exposure time will be forced to stay longer than 1/120 second. For cameras that come with fixed iris lens, setting the exposure time to longer than 1/120 second may introduce too much lights to the lens. Users can use this option to observe whether the result of long exposure time is satisfactory.

■ Exposure time: The Exposure time allows tuning for more or less light to enter the lens. The configurable value ranges from 1/32000 to 1/5 of a second. An optimum shutter speed should be maintained as long as the light level of the scene permits.

■ Gain control: Tune the slider bar to set the Gain Control to the best image quality. Higher gain control value will generate a certain amount of noise, and that the gain control, lighting levels, and picture performance are closely related.

Note that you can split the round pointers on the Exposure time and Gain control slide bars into two halves and drag them on the bars to designate a range of values in which firmware can automatically adapt to. Firmware will then automatically tune the Gain, Exposure time, and Iris opening within the ranges you specified.

You can click Restore to recall the original settings without incorporating the changes. When completed with the settings on this page, click Save to enable the settings.

If you want to configure another sensor setting for the schedule mode, please click Profile to open the Profile of exposure settings page as shown below.

Activated period: Select the period of time this profile setting will apply to. Please manually enter a range of time in a day, fune the Measurement window and Exposure control settings, and then check Save for the configuration to take effect.

Please follow the steps below to setup a profile:

  1. Check Enable and apply this profile to.
  2. Enter enter a range of time.
  3. Configure Exposure control settings in the following columns. Please refer to previous discussions for detailed information.
  4. Click Save to enable the setting and click Close to exit the page.

Profile of exposure settings FDB1684HTTP-V5 2013/02/09 09:31:50 Activated period Enable and apply this profile to Measurement window Full view BLC Exposure control Exposure level: 0 Flickiness Exposure time: 1/32000 - 1/30 Gain control: 0 - 100 % Restore Save Close

Privacy mask

Advanced Mode

Click Privacy Mask to open the settings page. On this page, you can block out sensitive zones to address privacy concerns.

Enable privacy mask (TCP-AV) Window Name X— Width— Y— Height— New Save Enable privacy mask (TCP-AV) 2010/12/09 17:08:5620 Window Name 2 X168 Width96 Y104 Height72 New Save

■ To set the privacy mask windows, follow the steps below:

  1. Click New to add a new window.
  2. You can use the mouse cursor to size and drag-drop the window, which is recommended to be at least twice the size of the object (height and width) you want to cover.
  3. Enter a Window Name and click Save to enable the setting.
  4. Click on the Enable privacy mask checkbox to enable this function.

Vivotek FD8166-F6 - Advanced Mode - 2

NOTE:

▶ Up to 5 privacy mask windows can be configured on the same screen.
▶ If you want to delete the privacy mask window, please click the 'x' mark on the upper right corner of the window.

Media > Video

Advanced Mode

Stream settings

Stream settings

» Video settings for stream 1

Viewing Window

Video settings for stream 2

Save

This Network Camera supports multiple streams with a frame size ranging from 176 x144 to 1920 x 1080.

The definition of multiple streams:

■ Stream 1: Users can define the "Region of Interest" (viewing region) and the "Output Frame Rate" (size of the live view window).

■ Stream 2: Stream 2 does not support the "Region of Interest" configuration.

Click Viewing Window to open the viewing region settings page. On this page, you can set the Region of Interest and the Output Frame Size for stream 1. For example, you can crop only a portion of the image that is of your interest, and thus save the bandwidth needed to transmit the video stream.

Video stream Stream 1 Region of interest (5.8) 1260x720 custom Output frame size: 1260x720 1260x720 646x360 384x216 176x144 Save Close

Please follow the steps below to set up those settings for a stream:

  1. Select a stream for which you want to set up the viewing region.
  2. Select a Region of Interest from the drop-down list. The floating frame, the same as the one in the Gloabl View window on the home page, will resize accordingly. If you want to set up a customized viewing region, you can also resize and drag the floating frame to a desired position with your mouse.
  3. Choose a proper Output Frame Size from the drop-down list according to the size of your monitoring device.

Medi: Video NOTE:

▶ All the items in the "Region of Interest" should not be larger than the "Output Frame Size" (current maximum resolution).

■ The parameters of the multiple streams:

Region of Interest Output frame size
Stream 1 1920 X 1080 ~ 176 x 144 (Selectable)1920 X 1080 ~ 176 x 144 (Selectable)
Stream 2 fixed fixed

When completed with the settings in the Viewing Window, click Save to enable the settings and click Close to exit the window. The selected Output Frame Size will immediately be applied to the Frame size of each video stream. Then you can go back to the home page to test the e-PTZ function. For more information about the e-PTZ function, please refer to page 87.

VIVOTEK Video zoom Manual trigger Plot speed Set speed Zone speed Global view Region of Interest (Viewing Region) X2.1

Output Frame Size (Size of the Live View Window)

Click the stream item to display the detailed information. The maximum frame size will follow your settings in the above Viewing Window sections.

Stream settings ✓ Video settings for stream 1 Viewing Window H.264 Frame size: 1312x784 Maximum frame rate: 15 fps Intra frame period: 1.5 Video quality ● Constant bit rate: Target bit rate: 3 Mbps Policy: Frame rate priority ○ Fixed quality: JPEG ✓ Video settings for stream 2 H.264 Frame size: 1200x720 Maximum frame rate: 30 fps Intra frame period: 1.5 Video quality ● Constant bit rate: Target bit rate: 2 Mbps Policy: Frame rate priority ○ Fixed quality: JPEG

This Network Camera offers real-time H.264 and MJPEG compression standards (Dual Codec) for real-time viewing. If the H.264 mode is selected, the video is streamed via RTSP protocol. There are several parameters for you to adjust the video performance:

Video settings for stream 1 Viewing Window H.264 Frame size: 1920x1080 Maximum frame rate: 15 fps Intra frame period: 1 S Video quality Constant bit rate: Target bit rate: 3 Mbps Policy: Frame rate priority Fixed quality:

■ Frame size

You can set up different video resolutions for different viewing devices. For example, set a smaller frame size and lower bit rate for remote viewing on mobile phones and a larger video size and a higher bit rate for live viewing on web browsers. Note that a larger frame size takes up more bandwidth.

■ Maximum frame rate

This limits the maximum refresh frame rate per second. Set the frame rate higher for smoother video quality and for recognizing moving objects in the field of view.

If the power line frequency is set to 50Hz, the frame rates are selectable at 1fps, 2fps, 3fps, 5fps, 8fps, 10fps, 15fps, 20fps, and 25fps. If the power line frequency is set to 60Hz, the frame rates are selectable at 1fps, 2fps, 3fps, 5fps, 8fps, 10fps, and 15fps, 20fps, 25fps, and 30fps. You can also select Customize and manually enter a value.

The frame rate will decrease if you select the higher resolution, such 1600x904 and 1920x1080.

■ Intra frame period

Determine how often to plant an I frame. The shorter the duration, the more likely you will get better video quality, but at the cost of higher network bandwidth consumption. Select the intra frame period from the following durations: 1/4 second, 1/2 second, 1 second, 2 seconds, 3 seconds, and 4 seconds.

■ Video quality

Constant bit rate:

- Constant bit rate: A complex scene generally produces a larger file size, meaning that higher bandwidth will be needed for data transmission. The bandwidth utilization is configurable to match a selected level, resulting in mutable video quality performance. The bit rates are selectable at the following rates: 20Kbps, 30Kbps, 40Kbps, 50Kbps, 64Kbps, 128Kbps, 256Kbps, 512Kbps, 768Kbps, 1Mbps, 2Mbps, 3Mbps, 4Mbps, 6Mbps, and 8Mbps. You can also select Customize and manually enter a value. This bit rate restriction method is particularly useful when planning a configuration consisting of numerous cameras where video streams can produce high demands both on network bandwidth and storage space. For example, storing a 6Mbps stream for 24 hours requires a 63GB disk space.

The Network Camera will strive to deliver video streams within the bit rate limitation you impose. If Frame Rate Priority is selected, the Network Camera will try to maintain the frame rate per second performance, while image quality will be compromised. If Image quality priority is preferred, the Network Camera will try to maintain the image quality of each frame, while the frame rate per second will be compromised.

- Fixed quality: On the other hand, if Fixed quality is selected, all frames are transmitted with the same quality; bandwidth utilization is therefore unpredictable. The video quality can be adjusted to the following settings: Medium, Standard, Good, Detailed, and Excellent. You can also select Customize and manually enter a value. The image quality will then be determined by the compression rate. For example, a lower quality means a higher compression rate. The higher the compression rate, the higher the possibility of image distortion, etc. You can also select Customize and manually enter a logical value from 0 to 51.

If JPEG mode is selected, the Network Camera sends consecutive JPEG images to the client, producing a moving effect similar to a filmstrip. Every single JPEG image transmitted guarantees the same image quality, which in turn comes at the expense of variable bandwidth usage. Because the media contents are a combination of JPEG images, no audio data is transmitted to the client. There are three parameters provided in MJPEG mode to control the video performance:

JPEG Frame size: 1920x1080 Maximum frame rate: 15 fps Video quality Constant bit rate: Target bit rate: 6 Mbps Policy: Frame rate priority Fixed quality:

■ Frame size

You can set up different video resolution for different viewing devices. For example, set a smaller frame size and lower bit rate for remote viewing on mobile phones and a larger video size and a higher bit rate for live viewing on web browsers. Note that a larger frame size takes up more bandwidth.

■ Maximum frame rate

This limits the maximum refresh frame rate per second. Set the frame rate higher for smoother video quality.

The frame rate will decrease if you select the higher resolution, such 1600x904 and 1920x1080.

If the power line frequency is set to 50Hz, the frame rates are selectable at 1fps, 2fps, 3fps, 5fps, 8fps, 10fps, 15fps, 20fps, and 25fps. If the power line frequency is set to 60Hz, the frame rates are selectable at 1fps, 2fps, 3fps, 5fps, 8fps, 10fps, 15fps, 20fps, 25fps, and 30fps. You can also select Customize and manually enter a value. The frame rate will decrease if you select a higher resolution.

■ Video quality

Refer to the previous discussion in the H.264 format settings on page 53 for the Constant bit rate and Fixed quality configurations.

Vivotek FD8166-F6 - ■ Video quality - 1

NOTE:

▶ If you configure a Customized value for the Fixed Quality setting in Video quality, the value will then represent the compression rate. In here, a lower value will produce higher quality.
▶ Converting high-quality video may significantly increase the CPU loading, and you may encounter streaming disconnection or video loss while capturing a complicated scene. In the event of such occurrence, we suggest you customize a lower video resolution or reduce the frame rate to obtain smooth video.

Media > Audio Advanced Mode

Audio Settings

Audio settings Mute Internal microphone input gain: 61% 0 100% Audio type G.711: pcmu Save

Mute: Select this option to disable audio transmission from the Network Camera to all clients. Note that if muted, no audio data will be transmitted even if audio transmission is enabled on the Client Settings page. In that case, the following message is displayed:

Warning The media type has been changed to video only because the media from server contains no audio OK

Internal microphone input gain: Select the gain of the external audio input according to ambient conditions by dragging the pointer on the slide bar.

Audio type: Advanced Mode.

■ G.711 provides good sound quality and requires about 64Kbps. Select pcmu ( -Law) or pcma (A-Law) mode.

When completed with the settings on this page, click Save to enable the settings.

Network > General settings

This section explains how to configure a wired network connection for the Network Camera.

Network Type

Network type Port LAN Get IP address automatically Use fixed IP address Enable UPnP presentation Enable UPnP port forwarding PPPoE Enable Pv6 Save

LAN

Select this option when the Network Camera is deployed on a local area network (LAN) and is intended to be accessed by local computers. The default setting for the Network Type is LAN. Please remember to click Save when you complete the Network setting.

Get IP address automatically: Select this option to obtain an available dynamic IP address assigned by the DHCP server each time the camera is connected to the LAN.

Use fixed IP address: Select this option to manually assign a static IP address to the Network Camera.

Network type Port LAN Get IP address automatically Use fixed IP address IP address: 192.168.4.140 Subnet mask: 255.255.255.0 Default router: 192.168.4.1 Primary DNS: 192.168.0.21 Secondary DNS: 192.168.0.22 Primary WINS server: 192.168.0.21 Secondary WINS server: 192.168.0.22 Enable UPnP presentation Enable UPnP port forwarding PPPoE Enable IPv6 Save

  1. You can make use of VIVOTEK Installation Wizard 2 on the software CD to easily set up the Network Camera on LAN. Please refer to Software Installation on page 12 for details.
  2. Enter the Static IP, Subnet mask, Default router, and Primary DNS provided by your ISP or consult your network administrator.

Subnet mask: This is used to determine if the destination is in the same subnet. The default value is "255.255.255.0".

Default router: This is the gateway used to forward frames to destinations in a different subnet. Invalid router setting will fail the transmission to destinations in different subnet.

Primary DNS: The primary domain name server that translates hostnames into IP addresses.

Secondary DNS: Secondary domain name server that backups the Primary DNS.

Primary WINS server: The primary WINS server that maintains the database of computer names and IP addresses.

Secondary WINS server: The secondary WINS server that maintains the database of computer names and IP addresses.

Enable UPnP presentation: Select this option to enable UPnP ^TM presentation for your Network Camera so that whenever a Network Camera is presented to the LAN, shortcuts of connected Network Cameras will be listed in My Network Places. You can click the shortcut to link to the web browser. Currently, UPnP ^TM is supported by Windows XP or later. Note that to utilize this feature, please make sure the UPnP ^TM component is installed on your computer.

My Network Places File Edit View Favorites Tools Help Back Search Folders Address My Network Places Go Network Tasks Local Network Add a network place View network connections Set up a home or small office network View workgroup computers Wireless Network Camera (192.168.5.128) Mega-pixel Network Camera (192.168.5.151) Wireless Network Camera with Pan/TR (192.168.5.141)

Enable UPnP port forwarding: To access the Network Camera from the Internet, select this option to allow the Network Camera to open ports on the router automatically so that video streams can be sent out from a LAN. To utilize of this feature, make sure that your router supports UPnP™ and it is activated.

PPPoE (Point-to-point over Ethernet)

Select this option to configure your Network Camera to make it accessible from anywhere as long as there is an Internet connection. Note that to utilize this feature, it requires an account provided by your ISP.

Follow the steps below to acquire your Network Camera's public IP address.

  1. Set up the Network Camera on the LAN.

  2. Go to Configuration > Event > Event settings > Add server (please refer to Add server on page 94) to add a new email or FTP server.

  3. Go to Configuration > Event > Event settings > Add media (please refer to Add media on page 99). Select System log so that you will receive the system log in TXT file format which contains the Network Camera's public IP address in your email or on the FTP server.

  4. Go to Configuration > Network > General settings > Network type. Select PPPoE and enter the user name and password provided by your ISP. Click Save to enable the setting.

Network type ○ LAN ● PPPoE User name: Password: Confirm password: □ Enable IPv6 Save

  1. The Network Camera will reboot.

  2. Disconnect the power to the Network Camera; remove it from the LAN environment.

Vivotek FD8166-F6 - PPPoE (Point-to-point over Ethernet) - 2

NOTE:

▶ If the default ports are already used by other devices connected to the same router, the Network Camera will select other ports for the Network Camera.
If UPnP ^TM is not supported by your router, you will see the following message: Error: Router does not support UPnP port forwarding.
▶ Steps to enable the UPnP ^TM user interface on your computer: Note that you must log on to the computer as a system administrator to install the UPnP ^TM components.

  1. Go to Start, click Control Panel, then click Add or Remove Programs.

Control Panel Pick a category Business and Services Services and Other Functions Software & Software Applications Sales, Taxis, Accessories, and Professional Services Information & Software Information & Software Information & Software

  1. In the Add or Remove Programs dialog box, click Add/Remove Windows Components.

Add or Remove Programs Currently installed programs: Apple Software Update Click here for support information. To change this program or remove it from your computer, click Change or Remove. Size: 2.10MB Used: rarely Last Used On: 327/2007 Change: Remove Installation Wizard Microsoft Office Professional Edition 2003 Macilla Firefox (2.0-0.8) PostgreSQL 8.2 QuickTime Virtual Machine Additions Vivotek Installation Wizard 2 VIVOTEX 577501 Windows Genuine Advantage Validation Tool (KB892130) Windows XP Netflix - KB823569 Windows XP Netflix - KB828741 Windows XP Netflix - KB833407 Windows XP Netflix - KB835732 Close

  1. In the Windows Components Wizard dialog box, select Networking Services and click Details.

Windows Components Wizard Windows Components You can add or remove components of Windows XP To add or remove a component, click the checkbox. A shaded box means that only part of the component will be installed. To use what's included in a component, click Details. Components: Message Gneaving 0.0 MB MSN Explorer 135 MB Networking Services 0.34 MB Other Network File and Print Services 0.0 MB Update Print Certificates 0.0 MB Descriptions: Contains a variety of specialized, network-related services and protocols. Total disk space required: 0.04 MB Space available on disk: 12125.4 MB Details... < Back Next > Cancel

  1. In the Networking Services dialog box, select Universal Plug and Play and click OK.

Networking Services To add or remove a component, click the check box. A shaded box means that only part of the component will be installed. To see what's included in a component, click Details. Subcomponents of Networking Services: RIP Listener 0.0 MB Simple TCP/IP Services 0.0 MB Universal Plug and Play 0.2 MB Description: Listens for route updates sent by routers that use the Routing Information Protocol version 1 (RIPv1). Total disk space required: 0.0 MB Space available on disk: 12125.4 MB Details... OK Cancel

  1. Click Next in the following window.

Windows Components Wizard Windows Components You can add or remove components of Windows XP. To add or remove a component, click the checkbox. A shaded box means that only part of the component will be installed. To see what's included in a component, click Details. Components: Message Queuing 0.0 MB MSN Explorer 13.5 MB Networking Services 0.3 MB Other Network File and Print Services 0.0 MB Update Float Certificates 0.0 MB Description: Contains a variety of specialized, network-related services and protocols Total disk space required 0.0 MB Space available on disk 12125.4 MB Details... < Back Next > Cancel

  1. Click Finish. UPnP ^TM is enabled.

▶ How does UPnP ^TM work?

UPnP ^TM networking technology provides automatic IP configuration and dynamic discovery of devices added to a network. Services and capabilities offered by networked devices, such as printing and file sharing, are available among each other without the need for cumbersome network configuration. In the case of Network Cameras, you will see Network Camera shortcuts under My Network Places.

▶ Enabling UPnP port forwarding allows the Network Camera to open a secondary HTTP port on the router-not HTTP port-meaning that you have to add the secondary HTTP port number to the Network Camera's public address in order to access the Network Camera from the Internet. For example, when the HTTP port is set to 80 and the secondary HTTP port is set to 8080, refer to the list below for the Network Camera's IP address.

From the Internet In LAN
http://203.67.124.123:8080 http://192.168.4.160 or http://192.168.4.160:8080

▶ If the PPPoE settings are incorrectly configured or the Internet access is not working, restore the Network Camera to factory default; please refer to Restore on page 41 for details. After the Network Camera is reset to factory default, it will be accessible on the LAN.

Enable IPv6

Select this option and click Save to enable IPv6 settings.

Please note that this only works if your network environment and hardware equipment support IPv6. The browser should be Microsoft® Internet Explorer 8.x, Mozilla Firefox 12 or above.

Network type LAN PPPoE User name: Password: Confirm password: Enable IPv6 IPv6 information Manually setup the IP address Save

When IPv6 is enabled, by default, the network camera will listen to router advertisements and be assigned with a link-local IPv6 address accordingly.

IPv6 Information: Click this button to obtain the IPv6 information as shown below.

[eth0 address] fe80:0000:0000:0000:0201:0aff:fe83:6408/64@Li [Gateway] fe80:352d:e315.83a5.4d12 [DNS] IPv6 address list of DNS Close

If your IPv6 settings are successful, the IPv6 address list will be listed in the pop-up window. The IPv6 address will be displayed as follows:

Refers to Ethernet

[eth0 address] 2001:0c08:2500:0002:0202:d1ff:fe04:65f4/64@Global fe80:0000:0000:0000:0202:d1ff:fe04:65f4/64@Link [Gateway] fe80:211:d8ff:fea2:1a2b [DNS] 2010:05c0:978d::

Please follow the steps below to link to an IPv6 address:

  1. Open your web browser.
  2. Enter the link-global or link-local IPv6 address in the address bar of your web browser.
  3. The format should be:

http://[2001:0c08:2500:0002:0202:d1ff:fe04:65f4]/ IPv6 address

  1. Press Enter on the keyboard or click Refresh button to refresh the webpage. For example:

Network Camera - Microsoft Internet Explorer File Edit View Favorites Tools Help Back Search Favorites Address http://[2001:0c08:2500:0002:0202:d1ff:fe04:65f4]/ VIVOTEK www.vivotek.com

Vivotek FD8166-F6 - Refers to Ethernet - 4

NOTE:

▶ If you have a Secondary HTTP port (the default value is 8080), you can also link to the webpage in the following address format: (Please refer to HTTP streaming on page 63 for detailed information.)

http://[2001:0c08:2500:0002:0202:d1ff:fe04:65f4]/:8080 IPv6 address Secondary HTTP port

▶If you choose PPPoE as the Network Type, the [PPP0 address] will be displayed in the IPv6 information column as shown below.

[eth0 address] fe80:0000:0000:0000:0202:d1ff:fe11:2299/64@Link [ppp0 address] fe80:0000:0000:0000:0202:d1ff:fe11:2299/10@Link 2001:b100:01c0:0002:0202:d1ff:fe11:2299/64@Global [Gateway] fe80::90:1a00:4142:8ced [DNS] 2001:b000::1

Manually setup the IP address: Select this option to manually set up IPv6 settings if your network environment does not have DHCPv6 server and router advertisements-enabled routers. If you check this item, the following blanks will be displayed for you to enter the corresponding information:

Enable IPv6

IPv6 information

√ Manually setup the IP address

Optional IP address / Prefix length

Optional default router

Optional primary DNS

Vivotek FD8166-F6 - IPv6 information - 1

Vivotek FD8166-F6 - IPv6 information - 2

Vivotek FD8166-F6 - IPv6 information - 3

Port

Network type

Port

HTTPS port:

443

FTP port:

21

Save

HTTPS port: By default, the HTTPS port is set to 443. It can also be assigned to another port number between 1025 and 65535.

FTP port: The FTP server allows the user to save recorded video clips. You can utilize VIVOTEK's Installation Wizard 2 to upgrade the firmware via FTP server. By default, the FTP port is set to 21. The FTP port can also be assigned to another port number between 1025 and 65535.

Network > Streaming protocols

Advanced Mode

HTTP streaming

To utilize HTTP authentication, make sure that your have set a password for the Network Camera first; please refer to Security > User account on page 73 for details.

HTTP streaming RTSP streaming Authentication: basic HTTP port: 80 Secondary HTTP port: 8080 Access name for stream 1: video.mjpg Access name for stream 2: video2.mjpg Access name for stream 3: videoany.mjpg Save

Authentication: Depending on your network security requirements, the Network Camera provides two types of security settings for an HTTP transaction: basic and digest.

If basic authentication is selected, the password is sent in plain text format and there can be potential risks of being intercepted. If digest authentication is selected, user credentials are encrypted using MD5 algorithm and thus provide better protection against unauthorized accesses.

HTTP port / Secondary HTTP port: By default, the HTTP port is set to 80 and the secondary HTTP port is set to 8080. They can also be assigned to another port number between 1025 and 65535. If the ports are incorrectly assigned, the following warning messages will be displayed:

Microsoft Internet Explorer HTTP port must be 80 or from 1025 to 65535 OK

Microsoft Internet Explorer Secondary HTTP port must be from 1025 to 65535 OK

To access the Network Camera on the LAN, both the HTTP port and secondary HTTP port can be used to access the Network Camera. For example, when the HTTP port is set to 80 and the secondary HTTP port is set to 8080, refer to the list below for the Network Camera's IP address.

On the LAN http://192.168.4.160 or http://192.168.4.160:8080

Access name for stream 1, 2, and 3: This Network camera supports multiple streams simultaneously. The access name is used to differentiate the streaming source. Users can click Media -> Video -> Stream settings to set up the video quality of linked streams. For more information about how to set up the video quality, please refer to Stream settings on page 50.

When using Mozilla Firefox to access the Network Camera and the video mode is set to JPEG, users will receive video comprised of continuous JPEG images. This technology, known as “server push”, allows the Network Camera to feed live pictures to Mozilla Firefox.

URL command -- http://:/ For example, when the Access name for stream 2 is set to video2.mjpg:

  1. Launch Mozilla Firefox or Netscape.
  2. Type the above URL command in the address bar. Press Enter.
  3. The JPEG images will be displayed in your web browser.

video2.mjpg (JPEG Image, 320x240 pixels) - Mozilla Firefox File Edit View History Bookmarks Tools Help http://192.168.5.151/video2.mjpg Customize Links Free Hotmail Windows Media Windows

Vivotek FD8166-F6 - HTTP streaming - 5

NOTE:

▶ Microsoft® Internet Explorer does not support server push technology; therefore, using the http://:/ command on IE will not work.
▶ Users can only use URL commands to request the stream 5. For more information about URL commands, please refer to page 117.

RTSP Streaming

To utilize RTSP streaming authentication, make sure that you have set a password for the Network Camera first; please refer to Security > User account on page 73 for details.

HTTP streaming RTSP streaming Authentication: disable Access name for stream 1: live.sdp Access name for stream 2: live2.sdp Access name for stream 3: liveany.sdp RTSP port: 554 RTP port for video: 5556 RTCP port for video: 5557 RTP port for audio: 5558 RTCP port for audio: 5559 Multicast settings for stream 1 Multicast settings for stream 2 Save

Authentication: Depending on your network security requirements, the Network Camera provides three types of security settings for streaming via RTSP protocol: disable, basic, and digest.

If basic authentication is selected, the password is sent in plain text format, but there can be potential risks of it being intercepted. If digest authentication is selected, user credentials are encrypted using MD5 algorithm, thus providing better protection against unauthorized access.

The availability of the RTSP streaming for the three authentication modes is listed in the following table:

Quick Time player VLC Player
Disable O O
Basic O O
Digest O X

Access name for stream 1, 2, and 3: This Network camera supports multiple streams simultaneously. The access name is used to differentiate the streaming source.

If you want to use an RTSP player to access the Network Camera, you have to set the video mode to H.264 and use the following RTSP URL command to request transmission of the streaming data.

rtsp://:/

For example, when the access name for stream 1 is set to live.sdp:

  1. Launch an RTSP player.
  2. Choose File > Open URL. A URL dialog box will pop up.
  3. Type the above URL command in the text box.
  4. The live video will be displayed in your player as shown below.

Vivotek FD8166-F6 - RTSP Streaming - 2

natural_image Interior view of a modern living room with wooden flooring, framed furniture, and large windows (no visible text or symbols)

Open URL Enter an Internet URL to open http://192.168.5.151:554/live.scp OK Cancel

RTSP port /RTP port for video, audio/ RTCP port for video, audio

■ RTSP (Real-Time Streaming Protocol) controls the delivery of streaming media. By default, the port number is set to 554.
■ The RTP (Real-time Transport Protocol) is used to deliver video and audio data to the clients. By default, the RTP port for video is set to 5556 and the RTP port for audio is set to 5558.
■ The RTCP (Real-time Transport Control Protocol) allows the Network Camera to transmit the data by monitoring the Internet traffic volume. By default, the RTCP port for video is set to 5557 and the RTCP port for audio is set to 5559.

The ports can be changed to values between 1025 and 65535. The RTP port must be an even number and the RTCP port is the RTP port number plus one, and thus is always an odd number. When the RTP port changes, the RTCP port will change accordingly.

If the RTP ports are incorrectly assigned, the following warning message will be displayed:

Microsoft Internet Explorer Invalid port number, RTP video port must be an even number. OK

Multicast settings for stream 1 & 2: Click the items to display the detailed configuration information. Select the Always multicast option to enable multicast for stream 1 or 2.

Multicast settings for stream 1: □ Always multicast Multicast group address: 239.128.1.99 Multicast video port: 5560 Multicast RTCP video port: 5561 Multicast audio port: 5562 Multicast RTCP audio port: 5563 Multicast TTL [1~255]: 15 Multicast settings for stream 2: □ Always multicast Multicast group address: 239.128.1.100 Multicast video port: 5564 Multicast RTCP video port: 5565 Multicast audio port: 5566 Multicast RTCP audio port: 5567 Multicast TTL [1~255]: 15

Unicast video transmission delivers a stream through point-to-point transmission; multicast, on the other hand, sends a stream to the multicast group address and allows multiple clients to acquire the stream at the same time by requesting a copy from the multicast group address. Therefore, enabling multicast can effectively save Internet bandwidth.

The ports can be changed to values between 1025 and 65535. The multicast RTP port must be an even number and the multicast RTCP port number is the multicast RTP port number plus one, and thus is always odd. When the multicast RTP port changes, the multicast RTCP port will change accordingly.

If the multicast RTP video ports are incorrectly assigned, the following warning message will be displayed:

Microsoft Internet Explorer Invaled port number. Multicast streams 1 video port must be an even number. OK

Multicast TTL [1\~255]: The multicast TTL (Time To Live) is the value that tells the router the range a packet can be forwarded.

Initial TTL Scope
0 Restricted to the same host
1 Restricted to the same subnetwork
32 Restricted to the same site
64 Restricted to the same region
128 Restricted to the same continent
255 Unrestricted in scope

Network > DDNS

This section explains how to configure the dynamic domain name service for the Network Camera. DDNS is a service that allows your Network Camera, especially when assigned with a dynamic IP address, to have a fixed host and domain name.

Express Link is a free service provided by VIVOTEK server, which allows users to register a domain name for a network device. One URL can only be mapped to one MAC address. This service will check out if the host name is valid and automatically open a port on your router. Unlike DDNS, the user has to manually check out UPnP port forwarding, Express Link is more convenient and easy to set up.

Express link Manual setup Enable express link http:// | .2bthere.net Help Save By Express link, all users need to do is create host name for the camera. It will generate the link to access the camera from internet.

Please follow the steps below to enable Express Link:

  1. Make sure that your router supports UPnP port forwarding and it is activated.
  2. Check Enable express link.
  3. Enter a host name for the network device and click Save. If the host name has been used by another device, a warning message will show up. If the host name is valid, it will show a message as shown below.

Express link Manual setup Enable express link http:// 0002D1123456 .2bthere.net The camera can now be accessed at http://0002D1123456.2bthere.net Help Save

Network Camera - Microsoft Internet Explorer File Edit View Favorites Tools Help Back Search Favorites https://0002D1123456.2bthere.net VIVOTEK Video Stream 1 Manual Trigger: Digital Output On Off Focus Assist On Off Mega-Pixel Network Camer Auto 100% 50% 25% (TCP-AV)

Manual setup

DDNS: Dynamic domain name service

DDNS: Dynamic domain name service

Enable DDNS:

Provider:

Host name:

User name:

Password:

Dyndns.org(Dynamic)

Vivotek FD8166-F6 - Manual setup - 1

Enable DDNS: Select this option to enable the DDNS setting.

Provider: Select a DDNS provider from the provider drop-down list.

VIVOTEK offers Safe100.net, a free dynamic domain name service, to VIVOTEK customers. It is recommended that you register Safe100.net to access VIVOTEK's Network Cameras from the Internet. Additionally, we offer other DDNS providers, such as Dyndns.org(Dynamic), Dyndns.org(Custom), TZO.com, DHS.org, CustomSafe100, dyn-interfree.it.

Note that before utilizing this function, please apply for a dynamic domain account first.

■ Safe100.net

  1. In the DDNS column, select Safe100.net from the drop-down list. Click I accept after reviewing the terms of the Service Agreement.
  2. In the Register column, fill in the Host name (xxxx.safe100.net), Email, Key, and Confirm Key, and click Register. After a host name has been successfully created, a success message will be displayed in the DDNS Registration Result column.

Register

Host name:

Email:

Key:

Confirm key:

WTK.safe100.net

wtk@vivotek.com

...

...

Forget key

To apply for a domain name for the camera, or to modify the previously registered information, fill in the following fields and then click "Register".

Register

DDNS Registration Result:

[Register] Successfully Your account information has been mailed to registered e-mail address

Upon successful registration, you can click copy to automatically upload relevant information to the DDNS form or you can manually fill it in. Then, click "Save" to save new settings.

  1. Click Copy and all the registered information will automatically be uploaded to the corresponding fields in the DDNS column at the top of the page as seen in the picture.

DDNS: Dynamic domain name service
Enable DDNS: Provider: Safe100.net Host name: VVTK.safe100.net Email: wtk@vivotek.com Key: ••••• [*.safe100.net]

Save

Register
Host name: WTK.safe100.net Email: wtk@vivotek.com Key: ••••• Forget key Confirm key: •••••

To apply for a domain name for the camera, or to modify the previously registered information, fill in the following fields and then click "Register".

Register

DDNS Registration Result:

[Register] Successfully Your account information has been mailed to registered e-mail address

Vivotek FD8166-F6 - Register - 3

Upon successful registration, you can click copy to automatically upload relevant information to the DDNS form or you can manually fill it in. Then, click "Save" to save new settings.

  1. Select Enable DDNS and click Save to enable the setting.

■ CustomSafe100

VIVOTEK offers documents to establish a CustomSafe100 DDNS server for distributors and system integrators. You can use CustomSafe100 to register a dynamic domain name if your distributor or system integrators offer such services.

  1. In the DDNS column, select CustomSafe100 from the drop-down list.
  2. In the Register column, fill in the Host name, Email, Key, and Confirm Key; then click Register. After a host name has been successfully created, you will see a success message in the DDNS Registration Result column.
  3. Click Copy and all for the registered information will be uploaded to the corresponding fields in the DDNS column.
  4. Select Enable DDNS and click Save to enable the setting.

Forget key: Click this button if you have forgotten the key to Safe100.net or CustomSafe100. Your account information will be sent to your email address.

Refer to the following links to apply for a dynamic domain account when selecting other DDNS providers:

■ Dyndns.org(Dynamic) / Dyndns.org(Custom): visit http://www.dyndns.com/

■ dyn-interfree.it: visit http://dyn-interfree.it/

Network > QoS (Quality of Service) Advanced Mode

Quality of Service refers to a resource reservation control mechanism, which guarantees a certain quality to different services on the network. Quality of service guarantees are important if the network capacity is insufficient, especially for real-time streaming multimedia applications. Quality can be defined as, for instance, a maintained level of bit rate, low latency, no packet dropping, etc.

The following are the main benefits of a QoS-aware network:

■ The ability to prioritize traffic and guarantee a certain level of performance to the data flow.

■ The ability to control the amount of bandwidth each application may use, and thus provide higher reliability and stability on the network.

Requirements for QoS

To utilize QoS in a network environment, the following requirements must be met:

■ All network switches and routers in the network must include support for QoS.

■ The network video devices used in the network must be QoS-enabled.

QoS models

CoS (the VLAN 802.1p model)

IEEE802.1p defines a QoS model at OSI Layer 2 (Data Link Layer), which is called CoS, Class of Service. It adds a 3-bit value to the VLAN MAC header, which indicates the frame priority level from 0 (lowest) to 7 (highest). The priority is set up on the network switches, which then use different queuing disciplines to forward the packets.

Below is the setting column for CoS. Enter the VLAN ID of your switch (0\~4095) and choose the priority for each application (0\~7).

CoS Enable CoS VLAN ID: 1 Live video: 0 Live audio: 0 Event/Alarm: 0 Management: 0

If you assign Video the highest level, the switch will handle video packets first.

Vivotek FD8166-F6 - CoS (the VLAN 802.1p model) - 2

NOTE:

▶ A VLAN Switch (802.1p) is required. The web browsing may fail if the CoS setting is incorrect.

▶ Class of Service technologies do not guarantee a level of service in terms of bandwidth and delivery time; they offer a "best-effort." Users can think of CoS as "coarsely-grained" traffic control and QoS as "finely-grained" traffic control.

▶ Although CoS is simple to manage, it lacks scalability and does not offer end-to-end guarantees since it is based on L2 protocol.

QoS/DSCP (the DiffServ model)

DSCP-ECN defines QoS at Layer 3 (Network Layer). The Differentiated Services (DiffServ) model is based on packet marking and router queuing disciplines. The marking is done by adding a field to the IP header, called the DSCP (Differentiated Services Codepoint). This is a 6-bit field that provides 64 different class IDs. It gives an indication of how a given packet is to be forwarded, known as the Per Hop Behavior (PHB). The PHB describes a particular service level in terms of bandwidth, queueing theory, and dropping (discarding the packet) decisions. Routers at each network node classify packets according to their DSCP value and give them a particular forwarding treatment; for example, how much bandwidth to reserve for it.

Below are the setting options of DSCP (DiffServ Codepoint). Specify the DSCP value for each application (0\~63).

QoS/DSCP Enable QoS/DSCP Live video: 0 Live audio: 0 Event/Alarm: 0 Management: 0

Save

Network > SNMP (Simple Network Management Protocol)

Advanced Mode

This section explains how to use the SNMP on the network camera. The Simple Network Management Protocol is an application layer protocol that facilitates the exchange of management information between network devices. It helps network administrators to remotely manage network devices and find, solve network problems with ease.

■ The SNMP consists of the following three key components:

  1. Manager: Network-management station (NMS), a server which executes applications that monitor and control managed devices.
  2. Agent: A network-management software module on a managed device which transfers the status of managed devices to the NMS.
  3. Managed device: A network node on a managed network. For example: routers, switches, bridges, hubs, computer hosts, printers, IP telephones, network cameras, web server, and database.

Before configuring SNMP settings on the this page, please enable your NMS first.

SNMP Configuration

Enable SNMPv1, SNMPv2c

Select this option and enter the names of Read/Write community and Read Only community according to your NMS settings.

Enable SNMPv1, SNMPv2c

SNMPv1, SNMPv2c Settings Read/Write community: Private Read only community: Public

Enable SNMPv3

This option contains cryptographic security, a higher security level, which allows you to set the Authentication password and the Encryption password.

■ Security name: According to your NMS settings, choose Read/Write or Read Only and enter the community name.
■ Authentication type: Select MD5 or SHA as the authentication method.
■ Authentication password: Enter the password for authentication (at least 8 characters).
■ Encryption password: Enter a password for encryption (at least 8 characters).

Enable SNMPv3

SNMPv3 Settings Read/Write Security name: Private Authentication Type: MD5 Authentication Password: Encryption Password: Read only Security name: Public Authentication Type: MD5 Authentication Password: Encryption Password:

Security > User Account

This section explains how to enable password protection and create multiple accounts.

Root Password

Root password Root password: Confirm root password: Save

The administrator account name is "root", which is permanent and can not be deleted. If you want to add more accounts in the Manage User column, please apply the password for the "root" account first.

  1. Type the password identically in both text boxes, then click Save to enable password protection.
  2. A window will be prompted for authentication; type the correct user's name and password in their respective fields to access the Network Camera.

Privilege Management

Advanced Mode

Root password Privilege management Account management Allow anonymous viewing Operator: PTZ control Viewer: PTZ control Save

PTZ control: You can modify the management privilege of operators or viewers. Check or uncheck the item, then click Save to enable the settings. If you give Viewers the privilege, Operators will also have the ability to control the Network Camera through the main page. (Please refer to user privilege Configuration on page 73).

Allow anonymous viewing: If you check this item, any client can access the live stream without entering a User ID and Password.

Account Management

Root password Privilege management Account management Existing user name —Add new user— User name User password Confirm user password Privilege: Administrator Administrator Operator Viewer Delete Add Update

Administrators can add up to 20 user accounts.

  1. Input the new user's name and password.
  2. Select the privilege level for the new user account. Click Add to enable the setting.

Access rights are sorted by user privilege (Administrator, Operator, and Viewer). Only administrators can access the Configuration page. Although operators cannot access the Configuration page, they can use the URL Commands to get and set the value of parameters. For more information, please refer to URL Commands of the Network Camera on page 117. Viewers access only the main page for live viewing.

Here you also can change a user's access rights or delete user accounts.

  1. Select an existing account to modify.
  2. Make necessary changes and click Update or Delete to enable the setting.

Security > HTTPS (Hypertext Transfer Protocol over SSL)

Advanced Mode

This section explains how to enable authentication and encrypted communication over SSL (Secure Socket Layer). It helps protect streaming data transmission over the Internet on higher security level.

Create and Install Certificate Method

Before using HTTPS for communication with the Network Camera, a Certificate must be created first. There are three ways to create and install a certificate:

Create self-signed certificate

  1. Select this option from a pull-down menu.
  2. In the first column, select Enable HTTPS secure connection, then select a connection option: "HTTP & HTTPS" or "HTTPS only".
  3. Click Create certificate to generate a certificate.

HTTPS Enable HTTPS secure connection Mode: HTTP & HTTPS HTTPS only Please wait while the certificate is being generated... Certificate: Certificate information Status: Not installed method: Create self-signed certificate Country: TW State or province: Asia Locality: Asia Organization: VIVOTEK.Inc Organization unit: VIVOTEK.Inc Common name: www.vivotek.com Validity: 3650 days Create certificate.

  1. The Certificate Information will automatically be displayed as shown below. You can click Certificate properties to view detailed information about the certificate.

Certificate information Status: Active method: Create self-signed certificate Country: TW State or province: Asia Locality: Asia Organization: VIVOTEK.Inc Organization unit: VIVOTEK.Inc Common name: www.vivotek.com Certificate properties Remove certificate

  1. Click Save to preserve your configuration, and your current session with the camera will change to the encrypted connection.
  2. If your web session does not automatically change to an encrypted HTTPS session, click Home to return to the main page. Change the URL address from "http://" to "https://" in the address bar and press Enter on your keyboard. Some Security Alert dialogs will pop up. Click OK or Yes to enable HTTPS.

https://
Network Camera - Microsoft Internet Explorer File Edit View Favorites Tools Help Back Search Favorites Address https://192.168.5.151/index.html Wireless Mega-Pixel Network Camera Video stream 1 Manual triggers: Pan speed: 0 Tilt speed: 0 Zoom speed: 0 Global view: Move Instantly Security Alert You are about to view pages over a secure connection. Any information you exchange with this site cannot be viewed by anyone else on the Web. In the future, do not show this warning OK More Info

Security Alert Information you exchange with this site cannot be viewed or changed by others. However, there is a problem with the site's security certificate. The security certificate was issued by a company you have not chosen to trust. View the certificate to determine whether you want to trust the certifying authority. The security certificate date is valid. The name on the security certificate is invalid or does not match the name of the site Do you want to proceed? Yes No View Certificate

Security Information This page contains both secure and nonsecure items. Do you want to display the nonsecure items? Yes No More Info

Create certificate request and install

  1. Select the option from the Method pull-down menu.
  2. Click Create certificate to proceed.
  3. The following information will show up in a pop-up window after clicking Create. Then click Save to generate the certificate request.

Certificate information Status: Not installed Method: Create certificate request and install Country: TW State or province: Asia Locality: Asia Organization: VIVOTEK Inc. Organization unit: VIVOTEK Inc. Common name: www.vivotek.com Please wait while the certificate is being generated... Create certificate

  1. The Certificate request window will prompt.

http://192.168.4.163/setup/security/certificate_request.html - Windows Intern Create certificate request completed Copy the PEM format request below and send it to a CA for identity validation. After that, you have to install it by clicking the "Upload" button on HTTPS page. Certificate request (PEM format) ----BEGIN CERTIFICATE REQUEST---- MITBaaOCARvCAQIwcaESMAkGAIOEeNbMCVFCxDTALBgHVBAgTREFsaNEsDTALBgMV BLnTREFsaNEsFTATBgNVBLnTDFZLfVvKDDugFWkJyKVNMCAIDCeCa60Wv1MT1DF BySjNedtMdtgqvFyYDVQDEkNsdmclblb3B3lay6Jh2DvgDsvDQVJNcIIhhvcNADES BQADyTOAMIGJAoGBALIFyjkyl1lCoutOMp43ICWUnugDEP1Q8a14HCTbcavtbipun/W ADDJAYkWhkLQqGpmpMy9orSTy05uSTbkhlAuMn/T9TRdy14UC0aDwnmBAg1816 EpmGI2PYXLI44VnhouslrcovwRIVNOsXLaflouDJUEKcCJURpWL8aJfs?vAAAgpSB AAGpADANBgqkhki19VhSAQAQUFAACBgQdGqGpdUclcbwMk1RRnBUSSEMShBr1KNqY rkigTELEKwDWESKAgIgHI4KxFNyAVRDsOLwOOOn/myKD8nJaIeEZWIAJhD1AlFm I2KMPI1AvC46aaOhSbqT3eSILM4V7llwClpQQHNmeEvUgHa4HYVyaRgdSaveQuJSFv IDMaxarflux=- ----END CERTIFICATE REQUEST----

If you see the following Information bar, click OK and click on the Information bar at the top of the page to allow pop-ups.

HTTPS - Microsoft Internet Explorer File Edit View Favorites Help Help Back Search Favorites Address http://192.160.3.151/setup/https.html Pop-up blocked. To see this pop-up or additional options click here... VIVOTEK Security > HTTPS System Security User account HTTPS Accounts Rail IEEE 802.5x Network Home Configuration Language Information Bar Did you notice the Information Bar? The Information Bar alerts you when Internet Explorer blocks a pop-up window or file download that might not be safe. It a Web page does not display property, look for the Information Bar (near the top of your browser) Do not show this message again Learn about the Information Bar... OK

  1. Look for a trusted certificate authority, such as Symantec's VeriSign Authentication Services, that issues digital certificates. Sign in and purchase the SSL certification service. Copy the certificate request from your request prompt and paste it in the CA's signing request window. Proceed with the rest of the process as CA's instructions on their webpage.

Symantec. Trust Center Free Trial Chat With Us Enter Certificate Signing Request (CSR) Server platform: Select one Sample CSR ORDER DETAILS Symantec™ SSL Test Certificates • Monthly period: 30 days Total: Free Trial: US $0 Paste Certificate Signing Request (CSFE): ----BEGI CERTIFICATE REQUEST---- MBRCCACAGAVGELNAGATLEBSMCYFCQCTALBGNVBAQTEFZWREJDTALBGNV BAFTDCGTRSLTATDGNVBAHTCFZAYMSPLNGDHSGLVDYMRDAAYECAMKABYT19F SvBtBtAUPPOVFDVVDVGGDEWCDDOuZHNARTCDSLNHATCTBnADNGBdNDAHVB48F AAOBCGARVYGPTEAGTSCHWZLTHLDSTFGPHDHLRLPAPN26MBSQDH2U5A SYVHDSSPQDNPCPDALWNTFSDGFWHGDGFWHGDZINHGDZINHGDZINHGDZINHGDZINHGDZINHGDZINHGDZINHGDZINHGDZINHGDZINHGDZINHGDZINHGDZINHGDZINHGDZINHGDZINHGDZINHGDZINHGDZINHGDZINHGDZINHGDZINHGDZINHGDZINHGDZEN SPNOLgywTNFBANPGNCQUTHPICVQYUCNPRGZGPESCZHFQSGAGMCAeEA AAAAMADDDCTCGGTBDQDBNVAAAADQAALDKHKGNCNBPfwnDFPSSLAJQTFSSImaE TFuWuBaingWYEDsFNDCCuWYFWDqPLQXLMNDHRYPyEwCZLDWbHGCH uDTfSAcGZVQIFpCqFthmEIDQVYVcWfESANBCradTf7afiprKGBPbq V230xVM ----END CERTIFICATE REQUEST... Total: US $0 Free Trial: < Back Cancel Continue Help What is a CSR? A CSR is generalised since your server and is your server's unique "Fingerprint". The CSR includes your server public key, which enables server authentication and ensure communication. Used with generating a CSR = Close Legal Notices | Primary | Reproductive | Feedback TrUSTs Norton

  1. Once completed, your SSL certificate should be delivered to you via an email or other means. Copy the contents of the certificate in the email and paste it in a text/HTML/hex editor/converter, such as IDM Computer Solutions' UltraEdit.

immediately, please dial 866.893.4543 or 650.426.5112 option 3 or send an email to internet-sales@verisign.com

Thank you for your interest in Symanter!

----BEGIN CERTIFICATE----

MIFNOCCA::qvpAldQAQfCalCahn/BrB15WQDQILsRbGpHk10WgBAQFADCB qvpLMAQALUENHCVVwEaVgVtNAeT0111c1taAinsLCdSntelTAcldYgVtQGL EydRc31gVpVndCBQsLwC NlcyEFmca3LAgTmbyKfsNckKtnmNlcy4x2gABdPv BaaTEV011111189mNtV2B86CbD8ksRwCecrOc7d3dy02KcXpIbnb5h2eV073Rs L3RicLrBYAaVykvGTENcaVAlDEAdWmVyaWlpI2agPbWpIWygUZyAII1PfI cnli1SQQAATEcYbSAKDTeyhDCwtAvaHDAAMToKDEYpDcwtYIsHKtLVWgw4x CtAJBgPbVTAALRXQvCwVTVQIEwBCs1lMnQvCWYHFARb21hdGUwEVYD VgQHYAFNTVYFEVLLeiLyty4xPTAtpBVSAoDFGfYvWnHGngSNtlyJyFNDgHA10E CKaWvTVQkBDqYpsNcI1F0F038dyI2X2KpcIainbIjn20rTVBaLSRlcXrtJY3As TywHETHXBGUALAGAxQsdIaLcDOE85H12tg0gVbQWuWflWcvtQABEQHBd yGAANIGDGAABHIdCoTcBdGfc-dhaAVTPVptHKDcYtsTaZunByLpdisIade60qDg pH+ayhtpTUgGSTIMwADRBSCFq/4xIPbQeGpWg5020GB/qgtmARKy1xwkPKn/B WakLINsLeVoIoCypxRaRCHQ-w4505DeRaHSdAbuHapgAkoBOhoNqzAgPdBAQ ggPHSHITACTWvSPBEEECEqGppHsdolcmDHCycLshnuTJALWgBHVEEAJAAAG4G AldHoEvwVqKAIFeTCBCGyVHRSGEAGHCglgAChj2edHHoEtVfU157Fv3PyrAm BaTsYtJaLnIcmlsaAwLiLeNbVt59TV1JtcUmlhbCyLshyDHRRGvNHFRAEJAAAG4G CMCSAGG-EKBHwMTNtAeTpgrEPgFCq(CAQAY)AvRIODMALYk3dsmdm/YakHpI24a T2YtL2WcyTGSDHY2BdQyDV0YBJDYAVBQDAaADGCsAGQTHeCHBB AldTvQdRbAaPCpKgEq9lgQJAYArTaZdaHHMtTlHQQQCCGACFpWRnEBDGpv2jAk BspRgEPgECQwCYtYYAaTCbcovLjycAcMdwYxaHpI24aNfPbHD4CCsAGQTHeAC bj7odHHoQtVfTl2FVPsYWaTetYNhLaIcmlsaAwLiNbVt59TV1JtcUmlhbCy LeiklyAaRqquenidWvSAQFAQPAeCAatUnTsnleX/TxtSerxXnELKSdPp qaqSewSwacI2IpPrSyErPe6TCLPdHerOPGyIaLFpAEUTTrSEICsCKNRBJApy12 qVhFBqFvgWNMeT7s4doUByarnafidShTvbubQz7tbyMeANhAH/P+euO5EveBra cfAhn/hqsqnogCkNytwcyeCNW8pgotSci368qKpPassrTowRajhpdaESUCAs 3RLJCKrsAgVtRadif-PLgtHgUg2AgNgaKcnTchNHcNAvgBnNucelII03TTRPCT nc6GlnylblgmfpYhRgVytDoVfZImn285qdu5qlsJAAPR/gi//XeRp=

  1. Open a new edit, paste the certificate contents, and press ENTER at the end of the contents to add an empty line.

[Edit1*] - UltralEdit File Edit Search Insert Project View Format Column Macro Scripting Advanced Window Help Project Open Explorer Lists Filter: A: B: C: D: E: F: Network: FTP Accounts Name Date modification Edit1* CmCGSAGG+EUBBxUwHTAvBggrBgEFBQcCARTJaHROcHM6Ly93d3cudmVyaJNpZ24u Y29tL2Nwcy90ZXN0T2xEwHQY6VR01BBTwFAYIKwYBBQUNAwEGCCsGAQUFBwMCND0G AlUdIwQYMBaAFCgXE4q91qK13AYst7a02h8mYG71MHQGCCsGAQUFBwEBBGgwTjAk BggrBgEFBQcwAYYYaHROdoDovL29jo3AudevVyaJNpZ24uY29tHD40CCsGAQUFBzAC hjJodHRwOiDvU1ZSVHJpYWwtRzltYv1hLnZlcmlaWduLnNbDS9TViJUcslhbEcy LmN1c3ANBgkqhx1G9wQBAQUFAAOCAQATxuH7FnIme/X7T6z/zsr9tZEhLKSEQSp qnaNoHnwixRcl2HPp3ksEKvp6TCLPSMrcOP0jPalLFxAKUITr3WlBCoXWRlAjNp12 qVUSBdfxgVMWx9T7rd2oURjms61fcM5Ttu3Qc2TulpWeARbAH/U+x+ojGOEvB3t ePamShn/qdapEcq00xVBycwHeCWNSRQgmGc1368qKPezmv7oErbnLhupjdxUEBSGExu 3M13CXrAtQ2v1RedifJQYSTgSONqIma9ghdKuKTnhCHUewgOxNNureIIB3ITPK70 m6CoTpntb1qmFtyj9EvgIUdc6YfImn2BOq3c5q3iFARPH/gi///XeGg== ----END CERTIFICATE---- Caoio Heli Macio Heli Sort List XML Manager

  1. Convert file format from DOS to UNIX. Open File menu > Conversions > DOS to Unix.

[Edit1*] - UltratEdit File Edit Search Insert Project View Format Column Macro Scripting Advanced Window Help Name Ctrl+N Open... Ctrl+O Quick Open... Ctrl+Q Close Close All Files Ctrl+Shift+F4 Close All Files Except Tgs F[P/Telnet Write to Save] Save Ctrl+S Save As... F12 Save All Alt+F12 Save Copy/Backup Encryption Rename File Coppare... Alt+F11 Sort Conversions Special Functions Print... Ctrl+P Print All Files Print Preview Print Setup/Configuration Favorite Files... Ctrl+Shift+F Recent Files Recent Projects/WorkSpace Cut 18 24 36 40 54 68 84 GNAGG+EUBEXUwNTAvRggrBgEFBQoCARYJaNROcHM6Ly93dJcoudeVyaXNpZZ4u tL2Nwcy90ZZNOTZEwBOYDVRO1BBTyFAYIKwYBBQUHAvEGCCsGAQUFBwBCHB0G diWQYMBaAPCcXE4q91qK13AYst7a02hBmY071MHQGCCsGAQUFBwEBBGgwZjAk rBgEFBQcwAYYYTaNROcDovL29jc2AudmVyaJNpZZ4uY29tMD4GCCsGAQUFBzAC pdHRwOv8vU1ZSVHJPYWwtRzItYWlhLnIcmlzaWduLnNbS9TV1JUcmllhbEcy lojANBgkghkiOGWwDBAQUFAAOCACKATxuH7FnIme/X7T6s/zsr9sEKhLKSEQRp cBavixSc129Pp3kzEKvp6TCLPGMbrOPGjPaILFxAEUITr3VIBCoXVR1AjVp12 bDfxgVWx91Trd2oURzjms61fcH5Tcub3Qe2Tu3pVeAKbAR/U+x+ojGOEvB3s thn/qcapKoq02vNyceVHeCWNbRQgsGe1368qkPssav7oXrbnl.hupjdxUKSOKxu DCXrAtQZv1RadiifJQYSTg50Nq2mk9ghdFuKTnhCHUwqwOxN8uceIIB3ITPK70 yPntblgmPtyj9EvgIUdc6YZImn2ROqSe5q3iZABPH/gi//ZeGg-- --END CERTIFICATE---- UND/MAC to DOS DOS to MAC DOS to UNIX EDCDIC to ASCII ASCII to EDCDIC OEM to AIGI ANSI to OEM ASCII to Unicode UTF-8 to Unipool Unicode to ABCD template List Global Power User

  1. Save the edit using the ".crt" extension, using a file name like "CAcert.crt."

[C:\Documents and Settings\we3c\Desktop\ files201*] - Altiaids File Edit Tools Insert Prompt View Paste Colors Mode Navigation Advanced Version Help Save As Project Open Explorer Lists Filter: A: C: D: E: F: Network FTP Accounts Save as: Desktop My Documents My Computer My Network Places Adobe Reader 9 File26a Client Google Chrome Installation Wizard 2 LiveClient McAfee Security Scan Plus Milestone XProtect Smart Client Mozilla Firefox Playback QuickTime Player RealPlayer TeamViewer 6 UltraCompare UltraEdit VIVO-TEX BlackholePM公用资料文 (位於 Blackhole) New Folder 44 45 46 802.1x 802.1x-1 802.1x-2 802.1x-3 access_alet activeX_plugin activeX_plugin1 File name: CAcet.cs Save as type: All Files (*.*) Save Cancel Line Terminator: Default Format: Default ADS Stream: All Data (Stream is only for files on https.dwg)

  1. Return to the original firmware session, use the Browse button to locate the crt certificate file, and click Upload to enable the certification.

Home Client settings Configuration Language Security > HTTPS System Media Network Security User accounts HTTPS Access list IEEE 802.txt PTZ [vent] Applications Recording Local storage [ Basic mode ] Version 0100c HTTPS Enable HTTPS secure connection Mode: HTTP & HTTPS HTTPS only Certificate: Certificate information Status: Waiting for certificated Select certificate file: C:\Documents and 8e Browse Upload Method: Create certificate request and install Country: TW State or province: Asia Locality: Asia Organization: VIVOTEK Inc. Organization unit: VIVOTEK Inc. Common name: www.vivotek.com Remove certificate

  1. When the certificate file is successfully loaded, its status will be stated as Active. Note that a certificate must have been created and installed before you can click on the "Save" button for the configuration to take effect.

HTTPS Enable HTTPS secure connection Mode: HTTP & HTTPS HTTPS only Certificate: Certificate information Status: Active Method: Create certificate request and install Country: TW State or province: Asia Locality: Asia Organization: VIVOTEK Inc. Organization unit: VIVOTEK Inc. Common name: www.vivotek.com Certificate properties Remove certificate Save

  1. To begin an encrypted HTTPS session, click Home to return to the main page. Change the URL address from "http://" to "https://" in the address bar and press Enter on your keyboard. Some Security Alert dialogs will pop up. Click OK or Yes to enable HTTPS.

Security Alert You are about to view pages over a secure connection. Any information you exchange with this site cannot be viewed by anyone else on the Web. □ In the future, do not show this warning OK More Info

Security Information This page contains both secure and nonsecure items. Do you want to display the nonsecure items? Yes No More Info

Security Alert Information you exchange with this site cannot be viewed or changed by others. However, there is a problem with the site's security certificate. The security certificate was issued by a company you have not chosen to trust. View the certificate to determine whether you want to trust the certifying authority. The security certificate date is valid. The name on the security certificate is invalid or does not match the name of the site Do you want to proceed? Yes No View Certificate

Enable HTTPS

Check this item to enable HTTPS communication, then select a connection option: "HTTP & HTTPS" or "HTTPS only". Note that you have to create and install a certificate first before clicking the Save button.

Enable HTTPS

Vivotek FD8166-F6 - Enable HTTPS - 1

Enable HTTPS secure connection:

Vivotek FD8166-F6 - Enable HTTPS - 2

HTTP & HTTPS Ⓞ HTTPS only

Save

Security > Access List Advanced Mode

This section explains how to control access permission by verifying the client PC's IP address.

General Settings

General settings Maximum number of concurrent streaming: 10 ▼ Connection management

Maximum number of concurrent streaming connection(s) limited to: Simultaneous live viewing for 1\~10 clients (including stream 1 and stream 2). The default value is 10. If you modify the value and click Save, all current connections will be disconnected and automatically attempt to re-link (IE Explore or Quick Time Player).

Connection management Click this button to display the connection status window showing a list of the current connections. For example:

IP addressElapsed timeUser ID
192.168.4.15000:00:51
192.168.4.12400:00:06

Vivotek FD8166-F6 - General Settings - 2

Note that only the consoles that are currently displaying live streaming will be listed in the management list.

■ IP address: Current connections to the Network Camera.

■ Elapsed time: How much time the client has been at the webpage.

■ User ID: If the administrator has set a password for the webpage, the clients have to enter a user name and password to access the live video. The user name will be displayed in the User ID column. If the administrator allows clients to link to the webpage without a user name and password, the User ID column will be empty.

There are some situations that allow clients access to the live video without a user name and password:

  1. The administrator does not set up a root password. For more information about how to set up a root password and manage user accounts, please refer to Security -> User account on page 73.

  2. The administrator has set up a root password, but set RTSP Authentication to "disable". For more information about RTSP Authentication, please refer to RTSP Streaming on page 64.

  3. The administrator has set up a root password, but allows anonymous viewing. For more information about Allow Anonymous Viewing, please refer to page 73.

■ Refresh: Click this button to refresh all current connections.
■ Add to deny list: You can select entries from the Connection Status list and add them to the Deny List to deny access. Please note that those checked connections will only be disconnected temporarily and will automatically try to re-link again (IE Explore or Quick Time Player). If you want to enable the denied list, please check Enable access list filtering and click Save in the first column.
■ Disconnect: If you want to break off the current connections, please select them and click this button. Please note that those checked connections will only be disconnected temporarily and will automatically try to re-link again (IE Explorer or Quick Time Player).

Enable access list filtering: Check this item and click Save if you want to enable the access list filtering function.

Filter

Filter type: Select Allow or Deny as the filter type. If you choose Allow Type, only those clients whose IP addresses are on the Access List below can access the Network Camera, and the others cannot access. On the contrary, if you choose Deny Type, those clients whose IP addresses are on the Access List below will not be allowed to access the Network Camera, and the others can access.

Filter Enable access list filtering Filter type: Allow Deny IPv4 access list Add Delete

Then you can Add a rule to the following Access List. Please note that the IPv6 access list column will not be displayed unless you enable IPv6 on the Network page. For more information about IPv6 Settings, please refer to Network -> General settings on page 56 for detailed information.

Please select the Enable access list filtering checkbox for your configuration to take effect.

There are three types of rules:

Single: This rule allows the user to add an IP address to the Allowed/Denied list.

For example:

Filter address Rule: Single IP address: 192.168.2.1 OK Cancel

Network: This rule allows the user to assign a network address and corresponding subnet mask to the Allow/Deny List. The address and network mask are written in CIDR format.

For example:

Filter address Rule: Network Network address / Network mask: 192.168.2.0 / 24 OK Cancel IP addresses 192.168.2.x will be bolcked.

Range: This rule allows the user to assign a range of IP addresses to the Allow/Deny List.

Note: This rule is only applied to IPv4.

For example:

Filter address Rule: Range IP address - IP address: 192.168.2.0 - 192.168.2.255 OK Cancel

Administrator IP address

Always allow the IP address to access this device: You can check this item and add the Administrator's IP address in this field to make sure the Administrator can always connect to the device.

Administrator IP address □ Always allow the IP address to access this device Save

Security > IEEE 802.1X Advanced Mode

Enable this function if your network environment uses IEEE 802.1x, which is a port-based network access control. The network devices, intermediary switch/access point/hub, and RADIUS server must support and enable 802.1x settings.

The 802.1x standard is designed to enhance the security of local area networks, which provides authentication to network devices (clients) attached to a network port (wired or wireless). If all certificates between client and server are verified, a point-to-point connection will be enabled; if authentication fails, access on that port will be prohibited. 802.1x utilizes an existing protocol, the Extensible Authentication Protocol (EAP), to facilitate communication.

■ The components of a protected network with 802.1x authentication:

Vivotek FD8166-F6 - Security &gt; IEEE 802.1X Advanced Mode - 1

flowchart
graph LR
    A["Supplicant\n(Network Camera)"] -->|1| B["Authenticator\n(Network Switch)"]
    B -->|2| C["Authentication Server\n(RADIUS Server)"]
    C -->|3| D["Viewer"]
  1. Supplicant: A client end user (camera), which requests authentication.

  2. Authenticator (an access point or a switch): A "go between" which restricts unauthorized end users from communicating with the authentication server.

  3. Authentication server (usually a RADIUS server): Checks the client certificate and decides whether to accept the end user's access request.

■ VIVOTEK Network Cameras support two types of EAP methods to perform authentication: EAP-PEAP and EAP-TLS.

Please follow the steps below to enable 802.1x settings:

  1. Before connecting the Network Camera to the protected network with 802.1x, please apply a digital certificate from a Certificate Authority (i.e., your network administrator) which can be validated by a RADIUS server.

  2. Connect the Network Camera to a PC or notebook outside of the protected LAN. Open the configuration page of the Network Camera as shown below. Select EAP-PEAP or EAP-TLS as the EAP method. In the following blanks, enter your ID and password issued by the CA, then upload related certificate(s).

IEEE 802.1x Enable IEEE 802.1x EAP method: EAP-PEAP Identity: Password: CA certificate: Browse... Upload Status: no file Remove

IEEE 802.1x

Vivotek FD8166-F6 - IEEE 802.1x - 1

Enable 802.1x

EAP method:

Identity:

Private key passord:

CA certificate:

Status: no file

client certificate:

Status: no file

Client private key:

Status: no file

EAP-TLS

Vivotek FD8166-F6 - EAP-TLS - 1

Vivotek FD8166-F6 - EAP-TLS - 2

Vivotek FD8166-F6 - EAP-TLS - 3

Browse.

Upload

Remove

Vivotek FD8166-F6 - EAP-TLS - 4

Browse.

Upload

Remove

Vivotek FD8166-F6 - EAP-TLS - 5

Browse.

Upload

Remove

  1. When all settings are complete, move the Network Camera to the protected LAN by connecting it to an 802.1x enabled switch. The devices will then start the authentication automatically.

Vivotek FD8166-F6 - EAP-TLS - 6

NOTE:

▶ The authentication process for 802.1x is as follows:

  1. The Certificate Authority (CA) provides the required signed certificates to the Network Camera (the supplicant) and the RADIUS Server (the authentication server).
  2. A Network Camera requests access to the protected LAN using 802.1X via a switch (the authenticator). The client offers its identity and client certificate, which is then forwarded by the switch to the RADIUS Server, which uses an algorithm to authenticate the Network Camera and returns an acceptance or rejection back to the switch.
  3. The switch also forwards the RADIUS Server's certificate to the Network Camera.
  4. Assuming all certificates are validated, the switch then changes the Network Camera's state to authorized and is allowed access to the protected network via a pre-configured port.

Vivotek FD8166-F6 - NOTE: - 1

flowchart
graph TD
    A["Certificate"] --> B["VIVOTEK Network Camera"]
    A --> C["Certificate Authority (CA)"]
    C --> D["Network Switch"]
    D --> E["RADIUS Server"]
    E --> F["Protected LAN"]
    F --> D
    style A fill:#f9f,stroke:#333
    style C fill:#f9f,stroke:#333
    style D fill:#ccf,stroke:#333
    style E fill:#cfc,stroke:#333
    style F fill:#fcc,stroke:#333

PTZ > PTZ settings

Advanced Mode

This section explains how to control the Network Camera's Pan/Tilt/Zoom operation.

There are two ways to enable the function:

The Digital name tag refers to the e-PTZ operation. It allows users to quickly move the focus to a target area for close-up viewing when the current field of view is smaller than the camera's maximum output frame size.

Digital PTZ Operation (E-PTZ Operation)
Digital FD test(TCP-V) 2013/03/10 17:08:56 x1.2 ▲ Home ▶ ▼ Zoom + Pan speed: 0 Tilt speed: 0 Zoom speed: 0 Auto pan/patrol speed: 1 Go to: -- Select one -- Preset and patrol settings Name: Add preset location User preset locations upper left lower left center upper right lower right Remove Select Preset Locations for Patrol Patrol locations Dwell time (sec) upper left 5 lower left 5 center 5 upper right 5 lower right 5 Remove ▲ ▼ Misc settings Zoom factor display Save

Please note that only stream #1 can possess its own preset and patrol settings. For detailed information about how to set up preset and patrol settings, please refer to page 87.

Auto pan/patrol speed: Select the speed from 1\~5 (slow/fast) to set up the Auto pan/patrol speed control.

When completed with the e-PTZ settings, click Save to enable the settings on this page.

Home page in E-PTZ Mode

VIVOTEK Video stream 1 Manual torgers 1.00 2.00 3.00 x3.1 Pain speed 0 Tst speed 8 Zoom speed 0 Global view Move instantly Go to seed one Direction: us right down left

■ The e-Preset Positions will also be displayed on the home page. Select one from the drop-down list, and the Network Camera will move to the selected e-preset position.

Global View

In addition to using the e-PTZ control panel, you can also use the mouse to drag or resize the floating frame to pan/tilt/zoom on the viewing region. The live view window will also move to the viewing region accordingly.

Moving Instantly

If you check this item, the live view window will switch to the new viewing region instantly after you move the floating frame. If not selected, the live view window will display the progress moving from one spot to another. However, the progress is not easily seen if the move is made across a small field of view.

Click on Image

The e-PTZ function also supports "Click on Image". When you click on any point of the Global View Window or Live View Window, the viewing region will also move to that point.

Note that the "Click on Image" function only applies when you have configured a smaller "Region of Interest" out of the maximum output frame, e.g., a 800x600 region from the camera's 1920x1080 maximum frame size.

Patrol settings

You can select some preset positions for the Network Camera to patrol.

Please follow the steps below to set up a patrol schedule:

  1. Select the preset locations on the list, and click >>.
  2. The selected preset locations will be displayed on the Patrol locations list.
  3. Set the Dwelling time for the preset location during auto patrol.
  4. If you want to delete a preset location from the Patrol locations list, select it and click Remove.

  5. Select a location and click ▲ ▼ to rearrange the patrol order.

  6. Select patrol locations you want to save in the list and click Save to enable the patrol settings.

  7. To implement the patrol schedule, please go to homepage and click on Patrol button. Please refer to the next page.

Digital Select stream: 1 FD test(TCP-V) 2012/3/21 16:53:35 x2.1 Pan speed: 0 Tilt speed: 0 Zoom speed: 0 Auto pan/patrol speed: 1 Go to: -- Select one -- Preset and patrol settings Name: Add preset location User preset locations upper left lower left center upper right lower right Remove Select Preset Locations for Patrol Patrol locations Dwell time (sec) upper left 5 3 lower left 5 center 5 upper right 5 lower right 5 Remove ▲ ▼ Misc settings Zoom factor display Save

Home page in the e-PTZ Mode

The Preset positions will also be displayed on the home page. Select one from the Go to drop-down list, and the Network Camera will move to the selected preset position.

Patrol button: Click this button, then the Network Camera will patrol among the selected preset positions continuously.

VIVOTEK Video stream: Manual triggers 100 mm 200 mm 300 mm Pan speed: 0 Tilt speed: 0 Zoom speed: 0 Global view: Move instantly Powered by VIVOTEK Mega-Pixel Network Camera HOME Client settings Configuration Language (TCP-RV) X 2.1 Select one Select one upper right lower right center upper left lower left

Vivotek FD8166-F6 - Home page in the e-PTZ Mode - 2

NOTE:

The Preset Positions will also be displayed on the home page. Select one from the Go to drop-down list, and the Network Camera will move to the selected preset position.
The Patrol button: The Network Camera will patrol along the selected positions repeatedly. Please refer to page 89 for more information.

Event > Event settings

Advanced Mode

This section explains how to configure the Network Camera to responds to particular situations (events). A typical application is that when a motion is detected, the Network Camera sends buffered images to an FTP server or e-mail address as event notifications. Click on Help, there is an illustration shown in the pop-up window explaining that an event can be triggered by many sources, such as motion detection or external digital input devices. When an event is triggered, you can specify what type of action that will be performed. You can configure the Network Camera to send snapshot images to your email address or send video clips to an FTP site.

Event Name Status Sun Mon Tue Wed Thu Fri Sat Time Trigger Add Help Event trigger → Action (What to do) Ex Motion detection, Periodically, Digital input System boot Media (What to send) Server (Where to send) Ex Snapshot, Video clip, System log Ex Email, FTP, HTTP server, Network storage Close

Event

To configure an event with recorded video or snapshots, it is necessary to configure the server and media settings so that the Network Camera will know what action to take (such as which server to send the media files to) when a trigger is activated. An event is an action initiated by a user-defined trigger source. In the Event column, click Add to open the event settings window. Here you can arrange three elements -- Schedule, Trigger, and Action to set an event. A total of 3 event settings can be configured.

Event Name Status Sun Mon Tue Wed Thu Fri Sat Time Trigger Add Help Event name: Enable this event Priority Normal Detect next motion detection or digital input after 10 seconds 1. Schedule 2. Trigger 3. Action Event Schedule Sun Mon Tue Wed Thu Fri Sat Time Always From 24:00 to 24:00 [hh:mm] Close Save event

■ Event name: Enter a name for the event setting.
■ Enable this event: Select this option to enable the event setting.
■ Priority: Select the relative importance of this event (High, Normal, or Low). Events with a higher priority setting will be executed first.
■ Detect next event after □ seconds: Enter the duration in seconds to pause motion detection after a motion is detected. This can prevent event-related actions to be too frequently performed.

1. Schedule

Specify the period of time during which the event trigger will take place. Please select the days of the week and the time in a day (in a 24-hr time format) for the event triggering schedule.

2. Trigger

This is the cause or stimulus which defines when to trigger the Network Camera. The trigger source can be configured to use the Network Camera's built-in motion detection mechanism or external digital input devices.

There are several choices of trigger sources as shown on the next page. Select the item to display the detailed configuration options.

■ Video motion detection

This option makes use of the built-in motion detection mechanism as a trigger source. To enable this function, you need to configure a Motion Detection Window first. For more information, please refer to Motion Detection on page 104 for details.

Video motion detection Normal: □ door Profile: □ hallway Note: Please configure Motion detection first

■ Periodically

This option allows the Network Camera to trigger an event periodically at the interval of configurable period of time. You can configure the interval into 1 to 999 minutes.

Periodically Trigger every other 1 minutes

■ Digital input

This option allows the Network Camera to use an external digital input device or sensor as a triggering source. Depending on your application, there are many choices of digital input devices on the market which can help to detect changes in temperature, vibration, sound, and light, etc.

■ System boot

This option triggers the Network Camera when the power to the Network Camera was lost and is now connected.

■ Recording notify

This option allows the Network Camera to trigger when the recording disk is full or when recording starts to rewrite older data.

■ Camera tampering detection

This option allows the Network Camera to trigger when the camera detects that is is being tampered with. To enable this function, you need to configure the Tampering Detection first. Please refer to page 107 for detailed information.

Camera tampering detection Enable camera tampering detection Trigger duration: 10 seconds [10-600] Save

■ Manual Trigger

This option allows users to enable event triggers manually by clicking the on/off button on the homepage. Please configure 1 to 3 associated events before using this function.

Vivotek FD8166-F6 - ■ Manual Trigger - 1

VIVOTEK WWW.VIVOTEK.COM Video Stream 1 Manual Trigger: 1 On Off 2 On Off 3 On Off

3. Action

Define the actions to be taken when a trigger is activated.

Action Backup media if the network is disconnected Server Media Extra parameter SD ----None ---- SD test View NAS ----None ---- Create folders by date time and hour automatically View Email ----None ---- Add server Add media

■ Backup media if the network is disconnected

Select this option to backup media file to the onboard SD card if the network is disconnected. This function will only be displayed after you set up an Action Server, such as a network storage (NAS).

Add server

To configure an event that will be recorded in video clips or snapshots, it is necessary to configure the server and media settings so that the Network Camera will know what action to take (such as which server to send the media files to) when a trigger is activated. Click Add server to open the server setting window. You can specify where the notification messages are sent when a trigger is activated. A total of 5 server settings can be configured.

There are four choices of server types available: Email, FTP, HTTP, and Network storage. Select the item to display the detailed configuration options. You can configure either one or all of them.

Add server Add media Server name: Email Server type Email Sender email address: Camera@vivotek.com Recipient email address: VIVOTEK@vivotek.com Server address: Ms.vivotek.tw User name: Password: Server port 25 This server requires a secure connection (SSL) FTP HTTP Network storage Test Close Save server

Server type - Email

Select to send the media files via email when a trigger is activated.

■ Server name: Enter a name for the server setting.
■ Sender email address: Enter the email address of the sender.
■ Recipient email address: Enter the email address of the recipient.
■ Server address: Enter the domain name or IP address of the email server.
■ User name: Enter the user name of the email account if necessary.
■ Password: Enter the password of the email account if necessary.
■ Server port: The default mail server port is set to 25. You can also manually set another port.

If your SMTP server requires a secure connection (SSL), check This server requires a secure connection (SSL).

To verify if the email settings are correctly configured, click Test. The result will be shown in a pop-up window. If successful, you will also receive an email indicating the result.

The email has been sent successfully.

Inoc a sending email.

Click Save server to enable the settings.

Note that after you set up the first event server, the new event server will automatically display on the Server list. If you wish to add other server options, click the Add server button again.

Server Media Extra parameter SD ----None---- ▼ SD test View Email ----None---- Add server Add media

Server type - FTP

Select to send the media files to an FTP server when a trigger is activated.

Server name: FTP Server Type Email FTP Server address: ftp.vivotek.com Server port: 21 User name: vivotek Password: ••••••• FTP folder name: ✓ Passive mode HTTP Network storage Test Save server Close

■ Server name: Enter a name for the server setting.
■ Server address: Enter the domain name or IP address of the FTP server.
■ Server port: By default, the FTP server port is set to 21. It can also be assigned to another port number between 1025 and 65535.
■ User name: Enter the login name of the FTP account.
■ Password: Enter the password of the FTP account.
■ FTP folder name

Enter the folder where the media file will be placed. If the folder name does not exist, the Network Camera will automatically create a folder on the FTP server.

■ Passive mode

Most firewalls do not accept new connections initiated from external requests. If the FTP server supports passive mode, select this option to enable passive mode FTP and allow data transmission to pass through the firewall. The firmware default has the Passive mode checkbox selected.

To verify if the FTP settings are correctly configured, click Test. The result will be shown in a pop-up window as shown below. If successful, you will also receive a test.txt file on the FTP server.

ftp transmission successfully.

http://192.160.5.121/kg-bin/admin/reserver.cgi ftp transmission failed.

Click Save server to enable the settings.

Server type - HTTP

Select to send the media files to an HTTP server when a trigger is activated.

Server name: HTTP Server Type Email FTP HTTP URL: http://192.168.5.10/cgi-bin/upload.cgi User name: Password: Network storage Test Save server Close

■ Server name: Enter a name for the server setting.
■ URL: Enter the URL of the HTTP server.
■ User name: Enter the user name if necessary.
■ Password: Enter the password if necessary.

To verify if the HTTP settings are correctly configured, click Test. The result will be shown in a pop-up window as below. If successful, you will receive a test.txt file on the HTTP server.

HTTP Transmission successfully. Thanks

HTTP Transmission failed.

Click Save server to enable the settings.

Network storage:

Select to send the media files to a network storage location when a trigger is activated. Please refer to NAS server on page 111 for details.

Click Save server to enable the settings.

Backup media if the network is disconnected Server Media Extra parameter SD ----None---- ▼ SD test View Email ----None---- FTP ----None---- HTTP ----None---- NAS ----None---- ▼ Create folders by date time and hour automatically View Add server Add media Close Save event

■ SD Test: Click to test your SD card. The system will display a message indicating success or failure. If you want to use your SD card for local storage, please format it before use. Please refer to page 99 for detailed information.
■ View: Click this button to open a file list window. This function is only for SD card and Network Storage. If you click the View button of SD card, a Local storage page will pop up for you to manage recorded files on SD card. For more information about Local storage, please refer to page 113. If you click the View button of Network storage, a file directory window will pop up for you to view recorded data on Network storage. For detailed illustration, please refer to the next page.
■ Create folders by date, time, and hour automatically: If you check this item, the system will generate folders automatically by the date when video footages are stored onto the networked storage.

The following is an example of a file destination containing video clips:

20100820 20100821 20100822 The format is: YYYYMMDD Click to open the directory Delete Delete all Click to delete all recorded data Click to delete selected items

Click 20110220 to open the directory:

The format is: HH (24r)

Click to open the file list for that hour

< 07 08 09 10 11 12 13 14 15 16 17 > file name size date time Recording1_58.mp4 2526004 2011/02/20 07:58:28 Recording1_59.mp4 2563536 2011/02/20 07:59:28 Delete Delete all Back Click to delete selected items Click to go back to the previous level of the directory Click to delete all recorded data

< 07 08 09 10 11 12 13 14 15 16 17 ≥ file name size date time Recording1_58 mp4 2526004 2011/02/20 07:58:28 Recording1_59 mp4 2563536 2011/02/20 07:59:28 Delete Delete all Back

The format is: File name prefix + Minute (mm)

You can set up the file name prefix on Add media page. Please refer to next page for detailed information.

Add media

Click Add media to open the media setting window. You can specify the type of media that will be sent when a trigger is activated. A total of 5 media settings can be configured. There are three choices of media types available: Snapshot, Video Clip, and System log. Select the item to display the detailed configuration options. You can configure either one or all of them.

Add server Add media Media name: Media type Attached media: Snapshot Source: Stream 1 Send 1 pre-event image(s) [0~7] Send 1 post-event image(s) [0~7] File name prefix: Snapshot_ ✓ Add date and time suffix to file name Video clip System log Close Save media

Media type - Snapshot

Select to send snapshots when a trigger is activated.

■ Media name: Enter a name for the media setting.
■ Source: Select to take snapshots from stream 1 \~ 2.
■ Send □ pre-event images

The Network Camera has a buffer area; it temporarily holds data up to a certain limit. Enter a number to decide how many images to capture before a trigger is activated. Up to 7 images can be generated.

■ Send □ post-event images

Enter a number to decide how many images to capture after a trigger is activated. Up to 7 images can be generated.

For example, if both the Send pre-event images and Send post-event images are set to 7, a total of 15 images are generated after a trigger is activated.

1 plc. 2 plc. 3 plc. 4 plc. 5 plc. 6 plc. 7 plc. 8 plc. 9 plc. 10 plc. 11 plc. 10 plc. 12 plc. 13 plc. 14 plc. 15 plc. Trigger Activation

■ File name prefix

Enter the text that will be appended to the front of the file name.

■ Add date and time suffix to the file name

Select this option to add a date/time suffix to the file name.

For example:

Snapshot_20101213_100341 File name prefix Date and time suffix The format is: YYYYMMDD_HHMMSS

Click Save media to enable the settings.

To note that after you set up the first media server, a new column for media server will automatically appear on the Media list. If you wish to add more other media options, click Add media.

Media type - Video clip

Select to send video clips when a trigger is activated.

Media name: video clip Media type Attached media: Snapshot Video clip Source: Stream 1 Pre-event recording: 0 seconds [0~9] Maximum duration: 5 seconds [1~20] Maximum file size: 500 Kbytes [50~4096] File name prefix: clip System log Save media Close

■ Media name: Enter a name for the media setting.
■ Source: Select the source of video clip.
■ Pre-event recording

The Network Camera has a buffer area; it temporarily holds data up to a certain limit. Enter a number to decide the duration of recording before a trigger is activated. Up to 9 seconds can be set.

■ Maximum duration

Specify the maximum recording duration in seconds. Up to 10 seconds can be set.

For example, if pre-event recording is set to five seconds and the maximum duration is set to ten seconds, the Network Camera continues to record for another 4 seconds after a trigger is activated.

1 sec, 2 sec, 3 sec, 4 sec, 5 sec, 6 sec, 7 sec, 8 sec, 9 sec, 10 sec. Trigger Activation

■ Maximum file size

Specify the maximum file size allowed.

■ File name prefix

Enter the text that will be appended to the front of the file name.

For example:

Video_20101213_100341 File name prefix Date and lime suffix The format is: YYYYMMDD_HHMMSS

Click Save media to enable the settings.

Media type - System log

Select to send a system log when a trigger is activated.

Media name: System log Media Type Attached media: ● Snapshot ○ Video Clip ● System log Close Save media

Click Save media to enable the settings, then click Close to exit the page.

Action Backup media if the network is disconnected Server Media Extra parameter SD None SD test View mail None email log snapshot Add serve media Close Save event

In the Event settings column, the Servers and Medias you configured will be listed; please make sure the Event -> Status is indicated as ON, in order to enable the event triggering action.

When completed, click Save event to enable the settings and click Close to exit Event Settings page. The new Event / Server settings / Media will appear in the event drop-down list on the Event setting page.

Please see the example of the Event setting page below:

Event Name Status Sun Mon Tue Wed Thu Fri Sat Time Trigger event1 ON V V V V V V V 00:00~24:00 seq Delete Add Help Server settings Name Wayt Address/Location HTTP http http://192.168.5.10 Delete Add Media Available memory space: 13000KB Name Wayt Snapshot snapshot Delete Video clipvideoclip Delete System log.systemlog Delete Add Customized script Name(Date Time Add

When the Event Status is ON, once an event is triggered by motion detection, the Network Camera will automatically send snapshots via e-mails.

If you want to stop the event trigger, you can click on the ON button to turn it to OFF status or click Delete to remove the event setting.

To remove a server setting from the list, select a server name from the drop-down list and click Delete. Note that you can only delete a server setting when it is not applied to an existing event setting.

To remove a media setting from the list, select a media name from the drop-down list and click Delete. Note that you can only delete a media setting when it is not applied to an existing event setting.

Customized Script

This function allows you to upload a sample script (.xml file) to the webpage, which will save your time on configuring the settings. Please note that there is a limited number of customized scripts you can upload; if the current amount of customized scripts has reached the limit, an alert message will prompt. If you need more information, please contact VIVOTEK technical support.

Customized Script Name Date Time User1 20081113 18:13:46 User2 20081113 18:11:32 Click to upload a file Add User1 Delete 1 1-8 20:30:00-20:30:00 trigger trigger Mail system log to email address of 0 1> /usr/bin/empolient -> "Motion" -> f IP?199@vi-votek.com -> b /war/log/Messages ->5 ns.vi-votek.tw - M & pudding.yang#private.com 0 Click to modify the script online Upload

Applications > Motion detection

This section explains how to configure the Network Camera to enable motion detection. A total of three motion detection windows can be configured.

Enable motion detection (TCP-V) 2011/11/3 14:39:12 Window name: hallway Sensitivity: 67% Percentage: 18% New Save Motion Detection Setting 1: For normal situations Profile Motion Detection Setting 2: For special situations

Follow the steps below to enable motion detection:

  1. Click New to add a new motion detection window.
  2. In the Window Name text box, enter a name for the motion detection window.

■ To move and resize the window, drag and drop your mouse on the window.
■ To delete a window, click the X mark on the upper right corner of the window.

  1. Define the sensitivity to moving objects and the space ratio of all alerted pixels by moving the Sensitivity and Percentage slider bar.
  2. Click Save to enable the settings.
  3. Select Enable motion detection to enable this function.

For example:

√ Enable motion detection

(TCP-V) 2011/11/3 14:39:12 Window name: hallway Sensitivity: 67% Percentage: 18% New Save

Profile

The Percentage Indicator will rise or fall depending on the variations between sequential images. When motions are detected by the Network Camera and are considered to have exceeded the defined threshold, the red bar rises. Meanwhile, the motion detection window will be outlined in red. Photos or videos can be captured instantly and configured to be sent to a remote server (Email, FTP) when using this feature as a trigger source. For more information on how to set an event, please refer to Event

settings on page 91.

A green bar indicates that even though motions have been detected, the event has not been triggered because the image variations still fall under the defined threshold.

Vivotek FD8166-F6 - For example: - 2

bar_stacked | Category | Value | | -------- | ----- | | Green | 30% | | Red | 30% |

If you want to configure other motion detection settings for a different time period within a day, please click Profile to open the Motion Detection Profile Settings page as shown below. A total of three motion detection windows can be configured on this page as well.

>Motion detection profile settings

FD test(TCP-V) 2000/1/1 06:33:08 Window name: sss Sensitivity: 0% Percentage: 0% New Save

General settings Enable this profile This profile is applied to: Schedule mode From 18:00 to 06:00 [hh:mm] Save Close

Please follow the steps beolw to set up a profile and additional motion detectio windows in it:

  1. Create a new motion detection window.
  2. Check Enable this profile.
  3. Select the applicable span of time in the Schedule mode. Please manually enter a time range if you choose Schedule mode.
  4. Click Save to enable the settings and click Close to exit the page.

This motion detection window will also be displayed on the Event Settings page. You can go to Event > Event settings > Trigger to choose it as a trigger source. Please refer to page 109 for detailed information.

Vivotek FD8166-F6 - &gt;Motion detection profile settings - 3

NOTE:

▶ How does motion detection work?

Enable motion detection DATE(TCP-AV) 2008/01/10 16:58:43 Window Name windowA Sensitivity 70% Percentage 30% New Flow

Vivotek FD8166-F6 - NOTE: - 2

natural_image Illustration of a cat playing with grass and leaves, displayed within a window labeled 'windowA' (no text or symbols on the image itself)

Enable motion detection DATE(TCP-AV) 2008/01/10 16:58:42 Window Name windowA Sensitivity 70% Percentage 30% New Save

Vivotek FD8166-F6 - NOTE: - 4

natural_image Illustration of a cartoon fish with green grass and rocks, displayed within a grid interface (no text or symbols on the fish or background)

There are two motion detection parameters: Sensitivity and Percentage. In the illustration above, frame A and frame B are two sequential images. Pixel differences between the two frames are detected and highlighted in gray (frame C) and will be compared with the sensitivity setting. Sensitivity is a value that expresses the sensitivity to moving objects. Higher sensitivity settings are expected to detect slight movements while smaller sensitivity settings will neglect them. When the sensitivity is set to 70%, the Network Camera defines the pixels in the purple areas as “alerted pixels” (frame D).

Percentage is a value that expresses the proportion of “alerted pixels” to all pixels in the motion detection window. In this case, 50% of pixels are identified as “alerted pixels”. When the percentage is set to 30%, the motions are judged to exceed the defined threshold; therefore, the motion window will be outlined in red.

For applications that require a high level of security management, it is suggested to use higher sensitivity settings and smaller percentage values.

Applications > Digital Input

Advanced Mode

Digital input

Normal status:

Vivotek FD8166-F6 - Applications &gt; Digital Input - 1

Current status:

High

Save

Connect a DI device to the camera's push-in type terminal block, the camera will automatically detect the current connection state as pulled-high or pulled-low. You may then define the Normal condition.

Normal status: Select High or Low to define the "Normal status" for the digital input. The Network Camera will report the current status below.

Applications > Tampering detection

This section explains how to set up camera tamper detection. With tamper detection, the camera is capable of detecting incidents such as redirection, blocking or defocusing, or even spray paint.

Camera tampering detection

Enable camera tampering detection

Trigger duration 10 seconds [10\~600]

Save

Please follow the steps below to set up the camera tamper detection function:

  1. Check Enable camera tampering detection.

  2. Enter the tamper trigger duration. (10 sec. \~ 10 min.) The tamper alarm will be triggered only when the tampering factor (the difference between current frame and pre-saved background) exceeds the trigger threshold.

  3. You can configure Tampering Detection as a trigger element to the proactive event configurations in Event -> Event settings -> Trigger. For example, when the camera is tampered with, camera can be configured to send pre- and post-event video clips to a networked storage device. Please refer to page 109 for detailed information.

Recording > Recording settings Advanced Mode

This section explains how to configure the recording settings for the Network Camera.

Recording Settings
Insert your SD card and click here to test Recording settings Name Status Sun Mon Tue Wed Thu Fri Sat Time Source Destination Delete Add SD test Note: Before setup recording, you may setup network storage via NAS server page

Vivotek FD8166-F6 - Recording &gt; Recording settings Advanced Mode - 2

NOTE:

▶ Please remember to format your SD card when using it for the first time. Please refer to page 113 for detailed information.

Recording Settings

Click Add to open the recording setting window. On this page, you can define the adaptive recording, recording source, recording schedule, and recording capacity. A total of 2 recording settings can be configured.

Recording name: Enable this recording With adaptive recording (Help) Pre-event recording: 5 seconds [0~9] Post-event recording: 5 seconds [0~10] Priority: Normal Source: Stream 1 1. Trigger 2. Destination Trigger Schedule Sun Mon Tue Wed Thu Fri Sat Time Always From 00:00 to 24:00 [hh:mm] Network fail Note: To enable recording notification please configure Event first Close Save

■ Recording name: Enter a name for the recording setting.
■ Enable this recording: Select this option to enable video recording.
■ With adaptive recording:

Selecting this option will activate the frame rate control according to alarm trigger.

The frame control means that when there is a triggered alarm, the frame rate will raise up to the value you've set on Video quality page. Please refer to page 50 for more information.

If you enable adaptive recording on Camera A, only when an event is triggered on Camera A will the server record the full frame rate streaming data; otherwise, it will only request the I frame data during normal monitoring, thus effectively save lots of bandwidth and storage space.

Vivotek FD8166-F6 - Recording Settings - 2

Vivotek FD8166-F6 - Recording Settings - 3

NOTE:

▶ To enable adaptive recording, please make sure you've set up the trigger source such as Motion Detection, DI Device, or Manual Trigger.
▶ When there is no alarm trigger:
- JPEG mode: record 1 frame per second.
- H.264 mode: record the I frame only.
- MPEG-4 mode: record the I frame only.
▶ When the I frame period is >1s on Video settings page, firmware will force decrease the I frame period to 1s when adaptive recording is enabled.

The alarm trigger includes: motion detection, tampering detection, and DI detection. Please refer to Event Settings on page 91.

■ Pre-event recording and post-event recording
The Network Camera has a buffer area (a flash memory); it temporarily holds data up to a certain limit. Enter a number to decide the duration of recording before and after a trigger is activated.
■ Priority: Select the relative importance of this recording (High, Normal, or Low). Recording with a higher priority setting will be executed first.
■ Source: Select a stream as the recording source.

Vivotek FD8166-F6 - NOTE: - 1

NOTE:

▶ To enable recording notification please configure Event settings first. Please refer to page 91.

Please follow the steps below to set up the recording.

1. Trigger

Select a trigger source.

Trigger Schedule Sun Mon Tue Wed Thu Fri Sat Time Always From 00:00 to 24:00 [hh:mm] Network fail

■ Schedule: The server will start to record files on the local storage or a networked storage (NAS).
■ Network fail: Since network fail, the server will start to record files on the local storage (SD card).

2. Destination

You can select the SD card or network storage (NAS) for the recorded video files.

Recording name: recording_Mylest Enable this recording With adaptive recording (Help) Priority: High Source: Stream 1 1. Trigger Destination: Destination: SD Recording file management Maximum duration: 1 minutes [1-60] Maximum file size: 108 MB [100-2000] File name prefix: recordingtest Add NAS server 2. Destination Note: To enable recording notification please configure Event first Save Close

NAS server

If you have not configured a NAS server, click Add NAS server to open the server setting window and follow the steps below to set up:

  1. Fill in the information for your server.

For example:

Vivotek FD8166-F6 - NAS server - 1

flowchart
graph TD
    A["1. Trigger"] --> B["2. Destination"]
    B --> C["Add NAS server"]
    C --> D["Server name: NAS"]
    D --> E["Server type"]
    E --> F["Network storage"]
    F --> G["Network storage location: \192.168.5.12NAS"]
    G --> H["(For example: \my_nas\disk\folder)"]
    H --> I["Workgroup: vivotek"]
    I --> J["User name: ritiali"]
    J --> K["Password: ********..."]
    K --> L["Test"]
    K --> M["Close"]
    K --> N["Save server"]

User name and password for your server

  1. Click Test to check the setting. The result will be shown in the pop-up window.

http://192.168.5.151/cgi-bin/admin/testserver... Mount successfully. Thanks Done Internet

http://192.168.5.151/cgi-bin/admin/testserver... Mount failed. Done Internet

If successful, you will receive a test.txt file on the network storage server.

NAS on ritali File Edit View Favorites Tools Help Back Search Folders Address \ritali\NAS File and Folder Tasks Rename this file Move this file Copy this file Publish this file to the Web E-mail this file Print this file Delete this file Other Places test.txt Text Document 1 KB test.txt - Notepad File Edit Format View Help [NOTIFICATION]The Result of Server Test of Your IP Camera

Vivotek FD8166-F6 - NAS server - 5

NOTE:

To edit or remove an existing NAS setting, you have to turn OFF all related event or recording configurations.

  1. Enter a server name.
  2. Click Save to complete the settings and click Close to exit the page.

Back to the Recording setup page, you can now record videos to the networked storage.

Recording name: recording_first Enable this recording With adaptive recording (Help) Priority: High Source: Stream 1 Destination Destination: NAS Capacity: Extra tree space Reserved space: 100 Mbytes Enable cyclic recording Recording file management Maximum duration: 1 minutes [1-50] Maximum file size: 10 MB [100-2000] File name prefix: recordingtest 1. Trigger 2. Destination Note: To enable recording notification please configure Event first Save Close

■ Capacity: You can choose either the entire free space available or limit the reserved space. The recording size limit must be larger than the reserved amount for cyclic recording.
■ File name prefix: Enter the text that will be appended to the front of the file name.
■ Enable cyclic recording: If you check this item, when the maximum capacity is reached, the oldest file will be overwritten by the latest one. The reserved amount is reserved for the transaction stage when the storage space is about to be full and new data arrives. The minimum for the Reserved space must be larger than 15 MBytes.

Recording file management

■ Maximum duration (minutes): Specifies the length of each of the recorded videos.
■ Maximum file size: (MB - Megabytes): Specifies the file size limitation of each recorded video. The duration and size are the upper thresholds. The limitation is imposed when either the length or the file size is reached. The recording then continues by creating other video files.
■ File name prefix: You may enter a file name prefix for the recorded files.

If you want to enable recording notification, please click Event to configure event triggering settings. Please refer to Event > Event settings on page 91 for more details.

When completed, select Enable this recording. Click Save to enable the setting and click Close to exit this page. When the system begins recording, it will send the recorded files to the network storage. The new recording name will appear in the drop-down list on the recording page as shown below.

To remove a recording setting from the list, select a recording name from the drop-down list and click Delete. — Recording Settings

Recording Settings Note: Before setup recording, you have to setup network storage first via Server page Name Status Sun Mon Tue Wed Thu Fri Sat Time Source Destination Video ON V V V V V V V 00:00~24:00 sream1 NAS Add SD Test Video Delete

■ Click Video (Name): Opens the Recording Settings page to modify.
- Click ON (Status): The Status will become OFF and stop recording.
■ Click NAS (Destination): Opens the file list of recordings as shown below. For more information about folder naming rules, please refer to page 97 for details.

20101210 20101211 20101212 Delete Delete all

Local storage > SD card management Advanced Mode

This section explains how to manage the local storage on the Network Camera. Here you can view SD card status, and implement SD card control.

SD card staus

This column shows the status and reserved space of your SD card. Please remember to format the SD card when using for the first time.

SD card status SD card status: Detached no SD card Total size: 0 KBytes Free size: 0 KBytes Used size: 0 KBytes Use (%): 0 % Format

SD card status SD card status: Ready Total size: 7810152 KBytes Free size: 7602048 KBytes Used size: 208104 KBytes Use (%): 2.665 % Format

SD card control

SD card control Enable cyclic storage Enable automatic disk cleanup Maximum duration for keeping files: 7 days Save

■ Enable cyclic storage: Check this item if you want to enable cyclic recording. When the maximum capacity is reached, the oldest file will be overwritten by the latest one.
■ Enable automatic disk cleanup: Check this item and enter the number of days you wish to retain a file. For example, if you enter "7 days", the recorded files will be stored on the SD card for 7 days.

Click Save to enable your settings.

Local storage > Content management

Advanced Mode

This section explains how to manage the content of recorded videos on the Network Camera. Here you can search and view the records and view the searched results.

Searching and Viewing the Records

This column allows the user to set up search criteria for recorded data. If you do not select any criteria and click Search button, all recorded data will be listed in the Search Results column.

Searching and viewing the records File attributes Trigger type: System boot Recording notify Motion Digital input Network fail Periodically Manual triggers Tampering detection Media type: Video clip Snapshot Text Locked: Locked Unlocked Backup: Backup Trigger time From: Date Time to: Date Time (yyyy-mm-dd) (hh:mm:ss) Search

■ File attributes: Select one or more items as your search criteria.
■ Trigger time: Manually enter the time range you want to search.

Click Search and the recorded data corresponding to the search criteria will be listed in Search Results window.

Search Results

The following is an example of search results. There are four columns: Trigger time, Media type, Trigger type, and Locked. Click to sort the search results in either direction.

Numbers of entries displayed on one page Enter a key word to filter the search results Show 10 entries Search: Trigger time Media Type Trigger type Locked Backup 2010-08-26 Video Clip Periodically No No 10:42:55 2010-08-26 Video Clip Periodically No No 10:43:56 2010-08-26 Video Clip Periodically No No 10:44:56 2010-08-26 Video Clip Periodically No No 10:45:57 2010-08-26 Video Clip Periodically No No 10:46:58 2010-08-26 Video Clip Periodically No No Highlight an item

■ View: Click on a search result which will highlight the selected item in purple as shown above. Click the View button and a media window will pop up to play back the selected file.

For example:

(Playback.AV) 2018/8/26 10:43:06 Small Medium Primary Close Click to adjust the image size

■ Download: Click on a search result to highlight the selected item in purple as shown above. Then click the Download button and a file download window will pop up for you to save the file.
■ JPEGs to AVI: This functions only applies to "JPEG" format files such as snapshots. You can select several snapshots from the list, then click this button. Those snapshots will be converted into an AVI file.

■ Lock/Unlock: Select the desired search results, then click this button. The selected items will become Locked, which will not be deleted during cyclic recording. You can click again to unlock the selections. For example:

Search results Show 10 entries ✓ Trigger time Media type Trigger type Locked Backup ✓ 2012-12-11 Video clip Motion No No 15:50:58 ✓ 2012-12-11 Video clip Motion Yes No 15:51:08 ✓ 2012-12-11 Video clip Motion No No 15:51:18 ✓ 2012-12-11 Video clip Motion No No 15:51:54 ✓ 2012-12-11 Video clip Motion No No 15:57:56 Showing 1 to 5 of 5 entries

Click to switch pages

Vivotek FD8166-F6 - Search Results - 4

■ Remove: Select the desired search results, then click this button to delete the files.

Appendix

URL Commands for the Network Camera

1. Overview

For some customers who already have their own web site or web control application, the Network Camera/Video Server can be easily integrated through URL syntax. This section specifies the external HTTP-based application programming interface. The HTTP-based camera interface provides the functionality to request a single image, control camera functions (PTZ, output relay etc.), and get and set internal parameter values. The image and CGI-requests are handled by the built-in Web server.

2. Style Convention

In URL syntax and in descriptions of CGI parameters, text within angle brackets denotes content that is to be replaced with either a value or a string. When replacing the text string, the angle brackets should also be replaced. An example of this is the description of the name for the server, denoted with in the URL syntax description below, that is replaced with the string myserver in the URL syntax example further down in the page.

URL syntax is denoted with the word "Syntax:" written in bold face followed by a box with the referenced syntax as shown below. For example, name of the server is written as and is intended to be replaced with the name of the actual server. This can either be a name, e.g., "mywebcam" or "thecam.adomain.net" or the associated IP number for the server, e.g., 192.168.0.220.

Syntax:

http:///cgi-bin/viewer/video.jpg

Description of returned data is written with "Return:" in bold face followed by the returned data in a box. All data is returned in HTTP format, i.e., each line is separated with a Carriage Return and Line Feed (CRLF) printed as \n.

Return:

HTTP/1.0 \r\n

URL syntax examples are written with "Example:" in bold face followed by a short description and a light grey box with the example.

Example: request a single snapshot image

http://mywebserver/cgi-bin/viewer/video.jpg

3. General CGI URL Syntax and Parameters

When the CGI request includes internal camera parameters, these parameters must be written exactly as they are named in the camera or video server. The CGIs are organized in functionally-related directories under the cgi-bin directory. The file extension .cgi is required.

Syntax:

http://<servername>/cgi-bin/<subdir>[/<subdir>...]/<cgi>.<ext>[?<parameter><value>[&<parameter><value>...]] 

Example: Set digital output #1 to active

http://mywebserver/cgi-bin/dido/setdo.cgi?do1=1 

4. Security Level

SECURITY LEVELSUB-DIRECTORY DESCRIPTION
0 anonymousUnprotected.
1 [view] anonymous, viewer, dido, camctrl1. Can view, listen, talk to camera.2. Can control DI/DO, PTZ of the camera.
4 [operator] anonymous, viewer, dido, camctrl, operatorOperator access rights can modify most of the camera's parameters except some privileges and network options.
6 [admin] anonymous, viewer, dido, camctrl, operator, adminAdministrator access rights can fully control the camera's operations.
7 N/A Internal parameters. Unable to be changed by any external interfaces.

5. Get Server Parameter Values

Note: The access right depends on the URL directory.

Method: GET/POST

Syntax:

http://<servername>/cgi-bin/anonymous/getparam.cgi?[<parameter>]
[&<parameter>...]

http://<servername>/cgi-bin/viewer/getparam.cgi?[<parameter>]
[&<parameter>...]

http://<servername>/cgi-bin/operator/getparam.cgi?[<parameter>]
[&<parameter>...]

http://<servername>/cgi-bin/admin/getparam.cgi?[<parameter>]
[&<parameter>...] 

Where the should be []. If you do not specify any parameters, all the parameters on the server will be returned. If you specify only , the parameters of the related group will be returned.

When querying parameter values, the current parameter values are returned.

A successful control request returns parameter pairs as follows:

Return:

HTTP/1.0 200 OK\r\n
Content-Type: text/html\r\n
Context-Length: <length>\r\n
\r\n
<parameter pair> 
where <parameter pair> is
<parameter>=<value>\r\n
[<parameter pair>] 

is the actual length of content.

Example: Request IP address and its response

Request:

http://192.168.0.123/cgi-bin/admin/getparam.cgi?network_ipaddress 

Response:

HTTP/1.0 200 OK\r\n

Content-Type: text/html\r\n

Context-Length: 33\r\n

\r\n

network_ipaddress=192.168.0.123\r\n

6. Set Server Parameter Values

Note: The access right depends on the URL directory.

Method: GET/POST

Syntax:

http://<servername>/cgi-bin/anonymous/setparam.cgi? <parameter>=<value>
[&<parameter>=<value>...][&return=<return page]

http://<servername>/cgi-bin/viewer/setparam.cgi? <parameter>=<value>
[&<parameter>=<value>...][&return=<return page]

http://<servername>/cgi-bin/operator/setparam.cgi? <parameter>=<value>
[&<parameter>=<value>...][&return=<return page]

http://<servername>/cgi-bin/admin/setparam.cgi? <parameter>=<value>
[&<parameter>=<value>...][&return=<return page] 
PARAMETER VALUE DESCRIPTION
value to assignedAssignto the parameter.
returnRedirect to the pageafter the parameter is assigned. Thecan be a full URL path or relative path according to the current path. If you omit this parameter, it will redirect to an empty page.(Note: The return page can be a general HTML file (.htm, .html). It cannot be a CGI command or have any extra parameters. This parameter must be placed at the end of the parameter list

Return:

HTTP/1.0 200 OK\r\n
Content-Type: text/html\r\n
Context-Length: <length>\r\n
\r\n
<parameter pair>
where <parameter pair> is
<parameter>=<value>\r\n
[<parameter pair>] 

Only the parameters that you set and are readable will be returned.

Example: Set the IP address of server to 192.168.0.123:

Request:

http://myserver/cgi-bin/admin/setparam.cgi?network_ipaddress=192.168.0.123

Response:

HTTP/1.0 200 OK\r\n

Content-Type: text/html\r\n

Context-Length: 33\r\n

\r\n

network_ipaddress=192.168.0.123\r\n

7. Available parameters on the server

This chapter defines all the parameters which can be configured or retrieved from VIVOTEK network camera or video server. The general format of description is listed in the table below

Valid values:

VALID VALUES DESCRIPTION
string[]Text strings shorter than ‘n’ characters. The characters “,',<,>,& are invalid.
string[n~m]Text strings longer than ‘n’ characters and shorter than ‘m’ characters. The characters “,',<,>,& are invalid.
password[] The same as string but displays ‘*’ instead.
integer Any number between (-2 ^31 - 1) and ( 2^31 - 1).
positive integer Any number between 0 and (2 ^32 - 1).
~Any number between ‘m’ and ‘n’.
domain name[] A string limited to a domain name shorter than ‘n’ characters (eg. www.ibm.com).
email address []A string limited to an email address shorter than ‘n’ characters (eg. joe@www.ibm.com).
ip address A string limited to an IP address (eg. 192.168.1.1).
mac address A string limited to contain a MAC address without hyphens or colons.
boolean A boolean value of 1 or 0 represents [Yes or No], [True or False], [Enable or Disable].
,,,,,,...Enumeration. Only given values are valid.
blankA blank string.
everything inside <>A description
integer primary keySQLite data type. A 32-bit signed integer. The value is assigned a unique integer by the server.
textSQLite data type. The value is a text string, stored using the database encoding (UTF-8, UTF-16BE or UTF-16-LE).
coordinatex, y coordinate (eg. 0,0)
window sizewindow width and height (eg. 800x600)

NOTE: The camera should not be restarted when parameters are changed.

7.1 system

Group: system

NAME VALUEDEFAULT SECURITY(get/set)DESCRIPTION
hostnamestring[64]Mega-Pixel Network Camera1/6 Host name of server
ledoff0 6/6 Turn on (0) or turn off (1) all ledindicators.
date6/6Current date of system. Set to‘keep’ to keep date unchanged.Set to ‘auto’ to use NTP to synchronize date.
time6/6Current time of the system. Set to‘keep’ to keep time unchanged.Set to ‘auto’ to use NTP to synchronize time.
datetime6/6Another current time format of the system.
ntp6/6 NTP server.*Do not use “skip to invoke default server” for default value.
timezoneindex-489 ~ 5293206/6Indicate timezone and area.-480: GMT-12:00 Eniwetok,Kwajalein-440: GMT-11:00 Midway Island,Samoa-400: GMT-10:00 Hawaii-360: GMT-09:00 Alaska-320: GMT-08:00 Las Vegas,San_Francisco,Vancouver-280: GMT-07:00 Mountain Time, Denver-281: GMT-07:00 Arizona-240: GMT-06:00 CentralAmerica, Central Time, Mexico City, Saskatchewan-200: GMT-05:00 Eastern Time, New York, Toronto-201: GMT-05:00 Bogota, Lima, Quito, Indiana-180: GMT-04:30 Caracas-160: GMT-04:00 Atlantic Time, Canada, La Paz, Santiago-140: GMT-03:30 Newfoundland-120: GMT-03:00 Brasilia, Buenos Aires, Georgetown, Greenland-80: GMT-02:00 Mid-Atlantic-40: GMT-01:00 Azores, Cape Verde IS.0: GMT Casablanca, Greenwich Mean Time: Dublin, Edinburgh, Lisbon, London40: GMT 01:00 Amsterdam, Berlin, Rome, Stockholm, Vienna, Madrid, Paris41: GMT 01:00 Warsaw, Budapest, Bern80: GMT 02:00 Athens, Helsinki, Istanbul, Riga81: GMT 02:00 Cairo82: GMT 02:00 Lebanon83: GMT 02:00 Israel120: GMT 03:00 Baghdad, Kuwait, Riyadh, St. Petersburg, Nairobi121: GMT 03:00 Iraq, Minsk140: GMT 03:30 Tehran160: GMT 04:00 Abu Dhabi, Moscow, Muscat, Baku, Tbilisi, Yerevan180: GMT 04:30 Kabul200: GMT 05:00 Ekaterinburg,
Islamabad, Karachi, Tashkent220: GMT 05:30 Calcutta,Chennai, Mumbai, New Delhi230: GMT 05:45 Kathmandu240: GMT 06:00 Almaty,Novosibirsk, Astana, Dhaka, SriJayawardenepura260: GMT 06:30 Rangoon280: GMT 07:00 Bangkok,Hanoi, Jakarta, Krasnoyarsk320: GMT 08:00 Beijing,Chongging, Hong Kong, KualaLumpur, Singapore, Taipei360: GMT 09:00 Osaka, Sapporo,Tokyo, Seoul, Yakutsk380: GMT 09:30 Adelaide,Darwin400: GMT 10:00 Brisbane,Canberra, Melbourne, Sydney,Guam, Vladivostok440: GMT 11:00 Magadan,Solomon Is., New Calcdonia480: GMT 12:00 Auckland,Wellington, Fiji, Kamchatka,Marshall Is.520: GMT 13:00 Nuku'Alofa
daylight_enable<boolean> 0 6/6Enable automatic daylight savingtime in time zone.
daylight_auto_begintimestring[19] NONE6/7 Display the current daylightsaving start time.
daylight_auto_endtimestring[19] NONE6/7 Display the current daylightsaving end time.
daylight_timezonesstring-360,-320,-280,-240,-241,-200,-201,-160,-140,-120,-80,-40,0,40,41,80,6/6 List time zone index whichsupport daylight saving time.
81,82,83,120,140,380,400,480
updateinterval0,3600,86400,604800,25920000 6/6 0 to Disable automatic timeadjustment, otherwise, it indicates the seconds between NTP automatic update intervals.
restore0,<positive integer>N/A 7/6 Restore the system parameters to default values afterseconds.
reset-1,0,<positive integer>N/A 7/6 Restart the server afterseconds ifis non-negative.
restoreexceptnet0,<positive integer>N/A 7/6 Restore the system parameters to default values except (ipaddress, subnet, router, dns1, dns2, pppoc).This command can cooperate with other “restoreexceptXYZ” commands. When cooperating with others, the system parameters will be restored to the default value except for a union of the combined results.
restoreexceptdst0,<positive integer>N/A 7/6 Restore the system parameters to default values except all daylight saving time settings.This command can cooperate with other “restoreexceptXYZ” commands. When cooperating with others, the system parameters will be restored to default values except for a union of combined results.
restoreexceptlang0,N/A 7/6 Restore the system parameters to default values except the custom language file the user has uploaded.This command can cooperate with other “restoreexceptXYZ” commands. When cooperating with others, the system parameters will be restored to the default value except for a union of the combined results.

7.1.1 system.info

Subgroup of system: info (The fields in this group are unchangeable.)

NAME VALUE DEFAULTSECURITY(get/set)DESCRIPTION
modelname string[40] FD81660/7Internal model name of the server (eg. FD8166)
serialnumber0/7 12 characters MAC address (without hyphens).
firmwareversion string[40]product dependent>0/7 Firmware version, including model, company, and version number in the format:
language_count90/7Number of webpage languages available on the server.
language_i<0~(count-1)>string[16]0/7 Available language lists.
customlanguage_maxcount10/6Maximum number of custom languages supported on the server.
customlanguage_count00/6Number of custom languages which have been uploaded to the server.
customlanguage_i<0~(max count-1)>string0/6 Custom language name.

7.2 status

Group: status

NAME VALUE DEFAULT SECURITY(get/set)DESCRIPTION
di_i<0~(ndi-1)>0 1/7 0 => Inactive, normal1 => Active, triggered (capability.ndi > 0)
onlinenum_rtsp integer 0 6/7 Current number ofRTSP connections.
onlinenum_httppush integer 0 6/7 Current number ofHTTP push server connections.
eth_i0 <string> <blank>1/7 Get networkinformation from mii-tool.
vi_i<0~(nvi-1)> <boolean> 0 1/7 Virtual input0 => Inactive1 => Active(capability.nvi > 0)

7.3 digital input behavior define

Group: di_i<0\~(ndi-1)>

NAMEVALUEDEFAULTSECURITY (get/set)DESCRIPTION
normalstatehigh, lowhigh1/1Indicates open circuit or closed circuit (inactive status)

7.4 security

Group: security

NAME VALUE DEFAULT SECURITY(get/set)DESCRIPTION
privilege_camctrl view, operator, adminview 1/6 Indicate which privileges and above can control PTZ (capability.ptzenabled >0 or capability.cptz >0)
user_i0_name string[64] root 6/7 User name of root
user_i<1~20>_name string[64] <blank> 6/7User name
user_i0_pass password[64]6/6Root password
user_i<1~20>_pass password[64]7/6User password7/6User password
user_i0_privilege view, operator, adminadmin6/7 Root privilege
user_i<1~20>_privilege view, operator, admin6/6User privilege

7.5 network

Group: network

NAMEVALUEDEFAULTSECURITY (get/set)DESCRIPTION
preprocessNULL6/6An 32-bit integer, each bit can be set separately as follows:Bit 0 => HTTP service;Bit 1=> HTTPS service;Bit 2=> FTP service;Bit 3 => Two way audio and RTSP Streaming service;To stop service before changing its port settings.It'srecommendedto set this parameter when change a service port to the port occupied by another service currently. Otherwise, the servicemay fail. Stopped service will auto-start after changing port settings. Ex: Change HTTP port from 80 to 5556, and change RTP port for video from 5556 to 20480. Then, set preprocess=9 to stop both service first. "/cgi-bin/admin/setparam.cgi? network_preprocess=9&network_http_port=5556 & network_rtp_videoport=20480"
typelan, pppoelan 6/6 Network connection type.
resetip1 6/61 => Get ipaddress, subnet, router, dns1, dns2 from DHCP server at next reboot. 0 => Use preset ipaddress, subnet, rounter, dns1, and dns2.
ipaddress6/6 IP address of server.
subnetSubnet mask.
routerDefault gateway.
dns1Primary DNS server.
dns2Secondary DNS server.
wins1Primary WINS server.
wins2Secondary WINS server.

7.5.1 802.1x

Subgroup of network: ieee8021x

NAME VALUE DEFAULT SECURITY(get/set)DESCRIPTION
enable0 6/6 Enable/disable IEEE 802.1x
eapmethod eap-peap, eap-tls eap-peap 6/6Selected EAP method
identity_peap string[64]<blank>6/6 PEAP identity
identity_tlsstring[64]6/6TLS identity
passwordstring[253]6/6Password for TLS
privatekeypasswordstring[253]6/6Password for PEAP
ca_exist<boolean> 0 6/6 CA installed flag
ca_timestring[20]0 6/7 CA installed time.Represented in EPOCH
ca_size string[20]0 6/7 CA file size (in bytes)
certificate_exist<boolean>06/6Certificate installed flag (for TLS)
certificate_timestring[20]0 6/7 Certificate installed time.Represented in EPOCH
certificate_sizestring[20]0 6/7 Certificate file size (in bytes)
privatekey_exist<boolean> 0 6/6 Private key installed flag(for TLS)
privatekey_timestring[20]0 6/7 Private key installed time.Represented in EPOCH
privatekey_sizestring[20]0 6/7 Private key file size (in bytes)

7.5.2 QOS

Subgroup of network: qos_cos

NAMEVALUEDEFAULTSECURITY (get/set)DESCRIPTION
enable06/6Enable/disable CoS (IEEE 802.1p)
vlanid1~409516/6VLAN ID
video0~706/6Video channel for CoS
audio0~706/6Audio channel for CoS (capability.naudio > 0)
eventalarm 0~7 06/6 Event/alarm channel for CoS
management0~706/6Management channel for CoS
eventtunnel 0~7 06/6 Event/Control channel for CoS

Subgroup of network: qos_dscp

NAME VALUEDEFAULT SECURITY(get/set)DESCRIPTION
enable06/6Enable/disable DSCP
video0~6306/6Video channel for DSCP
audio0~6306/6Audio channel for DSCP(capability.naudio > 0)
eventalarm 0~63 06/6Event/alarm channel for DSCP
management0~6306/6Management channel for DSCP
eventtunnel 0~63 06/6Event/Control channel for DSCP

7.5.3 IPV6

Subgroup of network: ipv6

NAMEVALUEDEFAULTSECURITY (get/set)DESCRIPTION
enable06/6Enable IPv6.
addonipaddress6/6IPv6 IP address.
addonprefixlen0~128646/6IPv6 prefix length.
addonrouter6/6IPv6 router address.
addondns6/6IPv6 DNS address.
allowoptional06/6Allow manually setup of IP address setting.

7.5.4 FTP

Subgroup of network: ftp

NAMEVALUEDEFAULTSECURITY (get/set)DESCRIPTION
port21, 1025~65535216/6Local ftp server port.

7.5.5 HTTP

Subgroup of network: http

NAME VALUE DEFAULT SECURITY(get/set)DESCRIPTION
port80, 1025 ~ 6553580 1/6 HTTP port.
alternateport 1025~65535 8080 6/6Alternate HTTP port.
authmodebasic,digestbasic 1/6 HTTP authentication mode.
s0_accessname string[32] video.mjpg1/6 HTTP server push access name for stream 1.(capability.protocol.spush_mjpeg=1 and capability.nmediastream >0)
s1_accessnamestring[32]video2.mjpg1/6 HTTP server push access name for stream 2.(capability.protocol.spush_mjpeg=1 and capability.nmediastream >1)
s2_accessnamestring[32]videoany.mjpg1/6 Http server push access name for stream 3(capability.protocol.spush_mjpeg=1 and capability.nmediastream >2)
anonymousviewing01/6Enable anonymous streaming viewing.

7.5.6 HTTPS port

Subgroup of network: https_port

NAMEVALUEDEFAULTSECURITY (get/set)DESCRIPTION
port443, 1025 ~ 655354431/6HTTPS port.

7.5.7 RTSP

Subgroup of network: rtsp

NAME VALUE DEFAULT SECURITY(get/set)DESCRIPTION
port 554, 1025~65535554 1/6 RTSP port.(capability.protocol.rtsp=1)
anonymousviewing0Enable anonymous streaming viewing.
authmodedisable, basic, digestdisable 1/6 RTSP authentication mode.(capability.protocol.rtsp=1)
s0_accessname string[3]live.sdp 1/6 RTSP access name for stream1.capability.protocol.rtsp=1 and capability.nmediastream >0)
s1_accessname string[3]live2.sdp 1/6 RTSP access name for stream2.(capability.protocol.rtsp=1 and capability.nmediastream >1)
s2_accessname string[3]liveany.sdp 1/6 RTSP access name for stream3(capability.protocol.rtsp=1 and capability.nmediastream >2)

7.5.7.1 RTSP multicast

Subgroup of network_rtsp_s<0\~(n-1)>: multicast, n is stream count

NAMEVALUEDEFAULTSECURITY (get/set)DESCRIPTION
alwaysmulticast04/4Enable always multicast.
ipaddressFor n=0, 239.128.1.99 For n=1, 239.128.1.100, and so on.4/4Multicast IP address.
videoport1025 ~ 655355560+n*24/4Multicast video port.
audiport1025 ~ 655355562+n*24/4Multicast audio port. (capability.naudio >0)
ttl 1~255 15 4/4Mutlicast time to live value.

7.5.8 RTP port

Subgroup of network: rtp

NAME VALUE DEFAULT SECURITY(get/set)DESCRIPTION
videoport 1025 ~ 65535 5556 6/6Video channel port for RTP.
audiport 1025 ~ 65535 5558 6/6Audio channel port for RTP.

7.5.9 PPPoE

Subgroup of network: pppoe (capability.protocol.pppoe > 0)

NAMEVALUEDEFAULTSECURITY (get/set)DESCRIPTION
userstring[128]6/6PPPoE account user name.
passpassword[64]6/6PPPoE account password.

7.6 ipfilter

Group: ipfilter

NAMEVALUEDEFAULTSECURITY (get/set)DESCRIPTION
enable06/6Enable access list filtering.
admin_enable06/6Enable administrator IP address.
admin_ipstring[43]6/6Administrator IP address.
maxconnection0~10106/6Maximum number of concurrent streaming connection(s).
type0, 116/6 Ipfilter policy :0 => allow1 => deny
ipv4list_i<0~9>Single address:Network6/6 IPv4 address list.
address:
address /network mask>Rangeaddress:<start ipaddress - end ipaddress>
ipv6list_i<0~9> string[43]6/6 IPv6 address list.

7.7 video input

Group: videooin

NAME VALUE DEFAULT SECURITY(get/set)DESCRIPTION
cmosfreq 50, 60 60 4/4 CMOS frequency.(capability.videoin.type=2)
whitebalance auto, manual, rbgainauto 4/4 “auto” indicates auto white balance. “manual” indicates keep current value. “rbgain” indicates using rgain and gbain.
exposurelevel 0~12 64/4 Exposure level
enableblc04/4 Enable backlight compensation.

7.7.1 video input setting per channel

Group: videoin_c<0\~(n-1)> for n channel products, and m is stream number

NAMEVALUEDEFAULTSECURITY (get/set)DESCRIPTION
cmosfreq50, 60604/4CMOS frequency. (capability.videoin.type=2)
whitebalanceauto, manual, rbgainauto 4/4 “auto” indicates autoauto white balance. “manual” indicates keep current value. “rbgain” indicates using rgain and gbain.
rgain 0~100 30 4/4 Manual set rgain value ofgain control setting.
bgain 0~100 30 4/4 Manual set bgain value ofgain control setting.
exposurelevel 0~12 6 4/4 Exposure level
maxgain 0~100 100 4/4 Manual set maximum gainvalue.
mingain 0~100 0 4/4 Manual set minimum gainvalue.
color 0, 1 14/4 0 => monochrome1 => color
flip04/4Flip the image.
mirror04/4Mirror the image.
ptzstatus21/7A 32-bit integer, each bit can be set separately as follows: Bit 0 => Support camera control function; 0 (not support), 1 (support) Bit 1 =>Built-in or external camera; 0 (external), 1 (built-in) Bit 2 => Support pan operation; 0 (not support), 1 (support) Bit 3 => Support tilt operation; 0 (not support), 1 (support) Bit 4 => Support zoom operation; 0 (not support), 1 (support) Bit 5 => Support focus operation; 0 (not support),1(support)
text string[40]1/4 Enclose caption.
imprinttimestamp0 4/4 Overlay time stamp onvideo.
flickerless0 4/4 Enable flickerless mode ornot.Enable flickerless mode will limit the parameters:minexposure and maxexposure between 5~120.
minexposure 5,15,25,30,50,60,100,120,240,250,480,500,1000,2000,4000,8000,16000,3200032000 4/4Minimum exposure time.
maxexposure5,15,25,30,50,60,100,120,240,250,480,500,1000,2000,4000,8000,16000,3200030 4/4Maximum exposure time.
enableblc 0~1 0 4/4 Enable backlightcompensation
s<0~(m-1>_codectypemjpeg, h264h2641/4Video codec type.svc is only supported with stream 0.
s<0~(m-1>_resolution"176~1920"x"144~1080"1920x10801/4 Video resolution in pixels.
s<0~(m-1>_h264_intraperiod250, 500,1000, 2000,3000, 400010004/4Intra frame period in milliseconds.
s<0~(m-1)>_h264_priority policyframerate, imagequalityframerate 4/4The policyto apply when the target bit rate is not sufficient to satisfy current encoded conditions. “framerate” indicates frame rate first. “imagequality” indicates image quality first.
s<0~(m-1)>_h264_ratecontrolmodecbr, vbr cbr 4/4cbr, constant bitratevbr, fix quality
s<0~(m-1)>_h264_quant1~5,99,1003 4/4 Quality of video when choosing vbr in “ratecontrolmode”. 99,100 is the customized manual input setting. 1 = worst quality, 5 = best quality.
s<0~(m-1)>_h264_qpercent1~100 454/4 Set quality by percentage.1: Worst quality 100: Best quality (s<0~(m-1)>_h264_quant = 100)
s<0~(m-1)>_h264_qvalue0~51294/4 Manual video quality level input. (s<0~(m-1)>_h264_quant = 99)
s<0~(m-1)>_h264_bitrate 1000~8000000 30000004/4 Set bit rate in bps when choosing cbr in “ratecontrolmode”.
s<0~(m-1)>_h264_maxvbrbitrate1000~4000000 0400000004/4 Maximum vbr bitrate
s<0~(m-1)>_h264_maxframe1~25, 26~30 (only for 60Hz CMOS)15 1/4 Set maximum framerate in fps (for h264).
s<0~(m-1)>_h264_profile0~211/4Indicate H264 profiles 0: baseline 1: main profile 2: high profile
s<0~(m-1)>_mjpeg_priority policyframerate, imagequalityframerate 4/4The policy toapply when the target bit rate is not sufficient to satisfy current encoded conditions. “framerate” indicates frame rate first. “imagequality” indicates image quality first.
s<0~(m-1)>_mjpeg_rate controlmodecbr, vbr cbr 4/4cbr, constantbitratevbr, fix quality
s<0~(m-1)>_mjpeg_quant 1 ~ 599, 1003 4/4Quality of video whenchoosing vbr in “ratecontrolmode”.99,100 is the customized manual input setting.1 = worst quality, 5 = best quality.
s<0~(m-1)>_mjpeg_maxframe1~25,26~30 (only for 60Hz CMOS)30 1/4 Set maximum framerate in fps (for JPEG).
s<0~(m-1)>_mjpeg_qvalue10~20049 4/4 Manual video qualitylevel input.(s<0~(m-1)>_mjpeg_quant = 99)
s<0~(m-1)>_mjpeg_qpercent1~100 494/4 Set qualityby percentage.1: Worst quality100: Best quality(s<0~(m-1)>_mjpeg_quant = 100)
s<0~(m-1)>_mjpeg_bitrate 1000~800000060000004/4 Set bit ratein bps when choosing cbr in “ratecontrolmode”.
s<0~(m-1)>_mjpeg_maxvbrbitrate1000~40000000400000004/4 Maximumvbr bitrate
s<0~(m-1)>_forcei 1NULL7/6 Force Iframe.

7.7.1.1 Alternative video input profiles per channel

In addition to the primary setting of video input, there can be alternative profile video input setting for each channel which might be for different scene of light (daytime or nighttime).

Group: videoin_c<0\~(n-1)>_profile_i<0\~(m-1)>

NAME VALUE DEFAULT SECURITY(get/set)DESCRIPTION
enable0 4/4 Enable/disable this profile setting
policy schedule schedule 4/4 The mode which the profile is applied to.
begintime hh:mm 18:00 4/4 Begin time of schedule mode.
endtimehh:mm 06:004/4 End time of schedule mode.
flickerless0 4/4 Enable flickerless mode or not.Enable flickerless mode will limit the parameters: minexposure and maxexposure between 5~120.
minexposure5,15,25,30,50,60,100,120,240,250,480,500,1000,2000,4000,8000,16000,32000320004/4 Minimumexposure time.
maxexposure5,15,25,30,50,60,100,120,240,250,480,500,1000,2000,4000,8000,16000,32000304/4 Maximumexposure time.
exposurelevel0~126 4/4 Exposure level
maxgain0~1001004/4Manual set maximum gain value.
mingain0~1000 4/4 Manual set minimum gain value.
enableble0 4/4 Enable backlight compensation.
whitebalanceauto,manual,rbgainauto4/4“auto” indicates auto white balance.“manual” indicates keepcurrent value.“rbgain” indicates using rgain
rgain 0~100 30 4/4Manual set rgainvalue of gaincontrol setting.
bgain 0~100 30 4/4Manual set bgainvalue of gaincontrol setting.

7.8 video input preview

The temporary settings for video preview

Group: videoinpreview

NAME VALUE DEFAULT SECURITY(get/set)DESCRIPTION
enableblc0 4/4 Preview of enable backlightcompensation.
minexposure5,15,25,30,50,60,100,120,240,250,480,500,1000,2000,4000,8000,16000,3200032000 4/4Minimum exposure time.
maxexposure5,15,25,30,50,60,100,120,240,250,480,500,1000,2000,4000,8000,16000,3200030 4/4Maximum exposure time.
exposurelevel0~1264/4Preview of exposure level
maxgain0~100 1004/4Manual set maximum gain value
mingain0~100 04/4Manual set minimum gain value

7.9 image setting per channel

Group: image_c<0\~(n-1)> for n channel products

NAME VALUE DEFAULT SECURITY(get/set)DESCRIPTION
brightness -5 ~ 5 -54/4 Adjust brightness of image according to mode settings.
saturation -5 ~ 5, 100100 4/4 Adjust saturation of image according to mode settings.100 means using the parameter “saturationpercent”.
contrast -5 ~ 5 0 4/4Adjust contrast of image according to mode settings.
sharpness-3 ~ 3, 1001004/4Adjust sharpness of image according to mode settings.100 means using the parameter “sharpnesspercent”
saturationpercent0 ~ 100504/4Adjust saturation of image by percentage. Less 0 <-> 100 More saturation
sharpnesspercent0~100504/4Adjust sharpness of image by percentage. Softer 0 <-> 100 Sharper
gammacurve0, 45 , 50,60, 70, 80,90, 10004/4 Gamma curve.
lowlightmode14/4 Enable/disable low light mode.
profile_i0_enable04/4 Enable/disable this profile setting
profile_i0_policyscheduleschedule4/4The mode which the profile is applied to.
profile_i0_begintimehh:mm18:004/4 Begin time of schedule mode.
profile_i0_endtimehh:mm06:004/4End time of schedule mode.
profile_i0_brightness-5 ~ 5 -5 4/4Adjust brightness of image according to mode settings.
profile_i0_saturation-5~5,1000 4/4 Adjust saturation of image according to mode settings.100 means using the parameter “saturationpercent”.
profile_i0_contrast-5 ~ 5 0 4/4 Adjust contrast of image according to
mode settings.
profile_i0_sharpness-3~3,100 04/4 Adjust sharpness of imageaccording to mode settings.100 means using the parameter “sharpnesspercent”
profile_i0_saturationpercent0~100 504/4 Adjust saturation of imageby percentage.Less 0 <-> 100 More saturation
profile_i0_sharpnesspercent0~100 504/4 Adjust sharpness of image by percentage.Softer 0 <-> 100 Sharper
profile_i0_lowlightmode14/4 Enable/disable low light mode.
profile_i0_gammacurve0, 45, 50,60, 70, 80,90, 1000 4/4 Gamma curve.

7.11 image setting for preview

Group: imagepreview_c<0\~(n-1)> for n channel products

NAME VALUEDEFAULT SECURITY(get/set)DESCRIPTION
brightness-5 ~ 5-54/4Adjust brightness of image according to mode settings.
saturation-5 ~ 5, 1001004/4Adjust saturation of image according to mode settings.100 means using the parameter “saturationpercent”.
contrast-5 ~ 5 0 4/4Adjust contrastof image according to mode settings.
sharpness-3 ~ 3, 1001004/4Adjust sharpness of image according to mode settings.100 means using the parameter “sharpnesspercent”
saturationpercent0 ~ 100504/4Adjust saturation of image by percentage. Less 0 <-> 100 More saturation
sharpnesspercent0~100504/4Adjust sharpness of image by percentage. Softer 0 <-> 100 Sharper
gammacurve0, 45 , 50,60, 70, 80,90, 10004/4 Gamma curve.
lowlightmode14/4 Enable/disable low light mode.

7.12 Audio input per channel

Group: audioin_c<0\~(n-1)> for n channel products

NAME VALUE DEFAULT SECURITY(get/set)DESCRIPTION
sourcelincin,lincin 4/4 micin => useexternal microphoneinput.linein => use built-in microphoneinput.
mute 0,101/4 Enable audio mute.
gain0~100654/4 Gain of input.(audioin_c<0~(n-1)>_source = linein)
s<0~(m-1)>_g711_modepcmu,pcmapcmu4/4 Set G.711mode.

7.13 Time Shift settings

Group: timeshift, c for n channel products, m is stream number

NAMEVALUEDEFAULTSECURITY(get/set)DESCRIPTION
enable04/4Enable time shift streaming.
c<0~(n-1)>_s<0~(m-1)>_allow04/4Enable time shift streaming for specific stream.

7.14 Motion detection settings

Group: motion_c<0\~(n-1)> for n channel product

NAMEVALUEDEFAULTSECURITY (get/set)DESCRIPTION
enable04/4Enable motion detection.
win_i<0~2>_enable04/4Enable motion window 1~3.
win_i<0~2>_namestring[14]4/4Name of motion window 1~3.
win_i<0~2>_left 0 ~ 3200 4/4 Left coordinate of windowposition.
win_i<0~2>_top 0 ~ 2400 4/4 Top coordinate of windowposition.
win_i<0~2>_width 0 ~ 3200 4/4 Width of motion detectionwindow.
win_i<0~2>_height 0 ~ 2400 4/4 Height of motion detectionwindow.
win_i<0~2>_objsize 0 ~ 1000 4/4 Percent of motion detectionwindow.
win_i<0~2>_sensitivity 0 ~ 1000 4/4 Sensitivity of motion detectionwindow.

Group: motion_c<0\~(n-1)> profile for m profile and n channel product

NAME VALUE DEFAULT SECURITY(get/set)DESCRIPTION
i<0~(m-1)>_enable04/4Enable profile 1 ~ (m-1).
i<0~(m-1)>_policyscheduleschedule4/4The mode which the profile is applied to.
i<0~(m-1)>_begintimehh:mm18:004/4Begin time of schedule mode.
i<0~(m-1)>_endtimehh:mm06:004/4End time of schedule mode.
i<0~(m-1)>_win_i<0~2>_enable04/4Enable motion window.
i<0~(m-1)>_win_i<0~2>_namestring[14]4/4Name of motion window.
i<0~(m-1)>_win_i<0~2>_left0 ~ 32004/4Left coordinate of window position.
i<0~(m-1)>_win_i<0~2>_top0 ~ 24004/4Top coordinate of window position.
i<0~(m-1)>_win_i<0~2>_width0 ~ 32004/4Width of motion detection window.
i<0~(m-1)>_win_i<0~2>_height0 ~ 24004/4Height of motion detection window.
i<0~(m-1)>_win_i<0~2>_objsize0 ~ 10004/4Percent of motion detection window.
i<0~(m-1)>_win_i<0~2>_sensitivity0 ~ 10004/4Sensitivity ofmotion detection window.

7.15 Tampering detection settings

Group: tampering_c<0\~(n-1)> for n channel product

NAME VALUEDEFAULTT SECURITY(get/set)DESCRIPTION
enable0 4/4Enable or disable tamper detection.
threshold 0~255 32 1/7Threshold of tamper detection.
duration 10~600 10 4/4If tampering value exceeds the ‘threshold’ formore than ‘duration’ second(s), then tamperdetection is triggered.

7.16 DDNS

Group: ddns

NAMEVALUEDEFAULTSECURITY (get/set)DESCRIPTION
enable06/6Enable or disable the dynamic DNS.
providerSafe100, DyndnsDynamic, DyndnsCustom, DynInterfree, CustomSafe100, PeanutHullDyndnsDynamic6/6Safe100 => safe100.netDyndnsDynamic => dyndns.org (dynamic)DyndnsCustom => dyndns.org (custom)DynInterfree =>dyn-interfree.itCustomSafe100 =>Custom server using safe100 methodPeanutHull => PeanutHull
颁布namestring[128]6/6Your DDNS hostname.
usernameemailstring[64]6/6Your user name or email to login to the DDNS service provider
passwordkeystring[64]6/6Your password or key to login to the DDNS service provider.
servernamestring[128]6/6The server name for safe100.(This field only exists if the provider is customsafe100)

Group:expresslink

NAME VALUE DEFAULT SECURITY(get/set)DESCRIPTION
enable06/6 Enable or disable express link.
stateonlycheck, onlyoffline, checkonline, badnetwork6/6“onlycheck”: You have to input the host name of your camera and press "Register" button to register it. “onlyoffline”: Express link is active, you can now connect to this camera at expresslink_url. “checkonline”: Express link is not active. “badnetwork”: Express Link is not supported under this network environment.
url string[63]6/6 The URL to connect to this camera by express link.
setparamlevel0~206/6Show log of parameter setting. 0: disable 1: Show log of parameter setting set from external. 2. Show log of parameter setting set from external and internal.

7.17 UPnP presentation

Group: upnppresentation

NAMEVALUEDEFAULTSECURITY (get/set)DESCRIPTION
enable16/6Enable or disable the UPnP presentation service.

7.18 UPnP port forwarding

Group: upnpportforwarding

NAME VALUE DEFAULT SECURITY(get/set)DESCRIPTION
enable06/6 Enable or disable the UPnP portforwarding service.
upnpnatstatus 0~3 06/7 The status of UPnP port forwarding,used internally.0 = OK, 1 = FAIL, 2 = no IGDrouter, 3 = no need for portforwarding

7.19 System log

Group: syslog

NAMEVALUEDEFAULTSECURITY (gct/set)DESCRIPTION
enableremotelog06/6Enable remote log.
serverip6/6Log server IP address.
serverport514, 1025~655355146/6Server port used for log.
level0~766/6Levels used to distinguish the importance of the information:0: LOG_EMERG1: LOG_ALERT2: LOG_CRIT3: LOG_ERR4: LOG_WARNING5: LOG_NOTICE6: LOG_INFO7: LOG_DEBUG

7.20 SNMP

Group: snmp

NAME VALUE DEFAULT SECURITY(get/set)DESCRIPTION
v2 0~1 0 6/6 SNMPv2 enabled. 0 fordisable, 1for enable
v3 0~1 0 6/6 SNMPv3 enabled. 0 fordisable, 1for enable
secnamerw string[31]Private 6/6 Read/write security name
secnamero string[31]Public 6/6 Read only security name
authpwrwstring[8~128]6/6Read/write authentication password
authpwrostring[8~128]6/6Read only authentication password
authtyperw MD5,SHAMD56/6 Read/write authentication type
authtypero MD5,SHAMD56/6 Read only authentication type
encryptpwrwstring[8~128]6/6Read/write passwd
encryptpwrostring[8~128]6/6Read only password
encrypttyperwDESDES6/6Read/write encryption type
encrypttyperoDESDES6/6Read only encryption type
rwcommunitystring[31] Private6/6 Read/write community
rocommunitystring[31] Public6/6 Ready only community

7.21 Layout configurationGroup: layout

NAMEVALUEDEFAULTSECURITY(get/set)DESCRIPTION
logo_default11/60 => Custom logo1 => Default logo
logo_linkstring[64]http://www.vivotek.com1/6Hyperlink of the logo
logo_powerbyvvtk_hidden01/60 => display the power byvivotek logo1 => hide the power by vivotek logo
theme_option 1~4 1 1/6 1~3: One of the default themes.4: Custom definition.
theme_color_font string[7] #ffffff 1/6 Font color
theme_color_configfont string[7] #ffffff 1/6 Font color of configurationarea.
theme_color_titlefont string[7] #098bd6 1/6 Font color of video title.
theme_color_controlbackgroundstring[7] #565656 1/6 Background colorof control area.
theme_color_configbackgroundstring[7] #323232 1/6 Background color of configuration area.
theme_color_videobackgroundstring[7]#565656 1/6 Background color of video area.
theme_color_case string[7] #323232 1/6 Frame color
custombutton_manualtrigger_show1 1/6 Show or hide manualtrigger(VI) button in homepage0 -> Hidden1 -> Visible

7.22 Privacy mask

Group: privacymask_c<0\~(n-1)> for n channel product

NAMEVALUEDEFAULTSECURITY (get/set)DESCRIPTION
enable04/4Enable privacy mask.
win_i<0~4>_enable04/4 Enable privacy mask window.
win_i<0~4>_namestring[40]4/4Name of the privacy mask window.
win_i<0~4>_left0 ~ 320/35204/4Left coordinate of window position.
win_i<0~4>_top0 ~ 240/28804/4Top coordinate of window position.
win_i<0~4>_width0 ~ 320/35204/4Width of privacy mask window.
win_i<0~4>_height 0~240/288 0 4/4Height of privacy maskwindow.

7.23 Capability

Group: capability

NAME VALUEDEFAULT SECURITY(get/set)DESCRIPTION
api_httpversion 0200a 0200a 0/7 The HTTP API version.
bootuptime600/7Server bootup time.
nir0,00/7 Number ofIR interfaces.(Recommend to use ir for built-in IR and extir for external IR)
npir0,00/7 Number ofPIRs.
ndi0,10/7 Number ofdigital inputs.
nvi0,30/7 Number ofvirtual inputs (manual trigger)
ndo0,00/7 Number ofdigital outputs.
naudioin0,10/7 Number ofaudio inputs.
naudioout0,00/7 Number ofaudio outputs.
nvideoin10/7Number of video inputs.
nvideoinprofile10/7Number of video input profiles.
nmediastream20/7Number of media stream per channels.
nvideosetting20/7Number of video settings per channel.
naudiosetting10/7Number of audio settings per channel.
nuart0,00/7 Number ofUART interfaces.
nmotion0,30/7Number of motion window.
nmotionprofile0,10/7Number of motion profiles.
ptzenabled 0,0 0/7 An32-bit integer, each bit can beset separately as follows:Bit 0 => Support camera control function;0(not support), 1(support)Bit 1 => Built-in or external video source;0(external), 1(built-in)Bit 2 => Support pan operation,0(not support), 1(support)Bit 3 => Support tilt operation;0(not support), 1(support)Bit 4 => Support zoom operation;0(not support), 1(support)Bit 5 => Support focus operation;0(not support), 1(support)Bit 6 => Support iris operation;0(not support), 1(support)Bit 7 => External or built-in PT;0(built-in), 1(external)Bit 8 => Invalidate bit 1 ~ 7;0(bit 1 ~ 7 are valid),1(bit 1 ~ 7 are invalid)Bit 9 => Reserved bit; Invalidate lens_pan, Lens_tilt, lens_zoon,lens_focus, len_iris.0(fields are valid),1(fields are invalid)Examples:PT8133: 0b1111SD8362: 0b111111VS8102: 0b10111101
windowless1 0/7 Indicate whether to supportwindowless plug-in.
eptz 0,1 0/7 A 32-bit integer, each bit can beset separately as follows:Bit 0 => stream 1 supports ePTZ or not.Bit 1 => stream 2 supports ePTZ or not.The rest may be deduced by analogy
npreset 0,20 0/7 Number of preset locations.
protocol_https <boolean> 1 0/7 Indicate whether to support HTTPover SSL.over SSL.
protocol_rtsp <boolean> 1 0/7 Indicate whether to support RTSP.
protocol_sip <boolean> 0 0/7 Indicate whether to support SIP.
protocol_maxconnection10 0/7 The maximum allowed simultaneous connections.
protocol_maxgen connection100/7The maximum general streaming connections .
protocol_maxmeg aconnection10 0/7 The maximum megapixel streaming connections.
protocol_rtp_multicast_ scalable1 0/7 Indicate whether to supportscalable multicast.
protocol_rtp_multicast_backchannel0 0/7 Indicate whether to supportbackchannel multicast.
protocol_rtp_tcp1 0/7 Indicate whether to support RTPover TCP.
protocol_rtp_http1 0/7 Indicate whether to support RTPover HTTP.
protocol_spush_m jpeg1 0/7 Indicate whether to support serverpush MJPEG.
protocol_snmp1 0/7 Indicate whether to supportSNMP.
protocol_ipv6 <boolean> 1 0/7 Indicate whether to support IPv6.
protocol_pppoc <boolean> 1 0/7 Indicate whether to supportPPPoE.
protocol_ieee8021x<boolean> 1 0/7 Indicate whether to supportIEEE802.1x.
protocol_qos_cos <boolean> 1 0/7 Indicate whether to support CoS.
protocol_qos_dscp<boolean> 1 0/7 Indicate whether to supportQoS/DSCP.
protocol_ddns <boolean> 1 0/7 Indicate whether to supportDDNS.
videoin_type 0, 1, 2 2 0/7 0 => Interlaced CCD1 => Progressive CCD2 => CMOS
videoin_resolution176x144,384x216,640x360,1280x720,1360x768,1600x904,1920x1080176x144,384x216,640x360,1280x720,1360x768,1600x904,1920x10800/7 Available resolutions list.
videoin_nresolution7 7 0/7 Available resolutions list.
videoin_maxframerate30,30,30,30,15,15,1530,30,30,30,15,15,150/7 Available maximum frame list.
videoin_mjpeg_maxframerate30,30,30,30,15,15,1530,30,30,30,15,15,150/7 Available maximum frame list.
videoin_h264_maxframerate30,30,30,30,15,15,1530,30,30,30,15,15,150/7 Available maximum frame list.
videoin_streamodec6,66,60/7Available stream codectype (Bit 0 -> mpeg4, Bit 1 -> mjpeg, Bit 2 -> h264, Bit 3 -> svc).
videoin_fov1920x1080 1920x10800/7 Available crop size list.
videoin_codecmjpeg, h264mjpeg, h2640/7 Available codec list.
timeshift<boolean> 1 0/7 Indicate whether to support timeshift caching stream.
audio_aec<boolean> 0 0/7 Indicate whether to support
acoustic echo cancellation.
audio_mic1 0/7 Indicate whether to supportbuilt-in microphone input.
audio_extmic0 0/7 Indicate whether to supportexternal microphone input.
audio_lincin0 0/7 Indicate whether to supportexternal line input.(It will be replaced by audio_mic and audio_extmic.)
audio_lineout0 0/7 Indicate whether to support lineoutput.
audio_headphone out0 0/7 Indicate whether to supportheadphone output.
audioin_codec g711 g711 0/7 Available codec list for audioinput.
uart_httptunnel0 0/7 Indicate whether to support HTTPtunnel for UART transfer.
camctrl_httptunnel0 0/7 The attribute indicates whethersending camera control commands through HTTP tunnel is supported.0: Not supported1: Supported
camctrl_privilege1 0/7 Indicate whether to support“Manage Privilege” of PTZ control in the Security page.1: support both/cgi-bin/camctrl/camctrl.cgi and/cgi-bin/viewer/camctrl.cgi0: support only/cgi-bin/viewer/camctrl.cgi
transmission_modeTx Tx 0/7 Indicate transmission mode of themachine: TX = server, Rx = receiver box, Both = DVR.
network_wire1 0/7 Indicate whether to supportEthernet.
network_wireless0 0/7 Indicate whether to supportwireless.
wireless_s802dot11b0 0/7 Indicate whether to supportsupportwireless 802.11b+.
wireless_s802dot11g0 0/7 Indicate whether to supportsupportwireless 802.11g.
wireless_encrypt_wcp0 0/7 Indicate whether to supportsupportwireless WEP.
wireless_encrypt_wpa0 0/7 Indicate whether to supportsupportwireless WPA.
wireless_encrypt_wpa20 0/7 Indicate whether to supportsupportwireless WPA2.
derivative_brand1 0/7 Indicate whether to support theupgrade function for the derivative brand. For example, if the value is true, the VVTK product can be upgraded to VVXX. (TCVV<->TCXX is excepted)
evctrlchannel1 0/7 Indicate whether to support HTTPtunnel for event/control transfer.
joystick1 0/7 Indicate whether to supportjoystick control.
storage_dbenable d1 0/7 Media files are indexed indatabase.
nanystream 0,1 0/7 number of any media stream per channelchannel
iva0 0/7 Indicate whether to supportIntelligent Video analysis
ir1 0/7 Indicate whether to supportbuilt-in IR led.
extir0 0/7 Indicate whether to supportexternal IR led.
whitelight0 0/7 Indicate whether to support whitelight led.
iris0 0/7 Indicate whether to support iriscontrol.
tampering1 0/7 Indicate whether to supporttampering detection.
temperature0 0/7 Indicate whether to supporttemperature detection.
image_wdrc0 0/7 Indicate whether to supportWDRC0 0/7 Indicate whether to supportWDRC
image_iristypedciris 0/7 Indicate iris type.
image_focusassist0 0/7 Indicate whether to support focus assist.0 0/7 Indicate whether to support focus assist.
localstorage_manageable1 0/7 Indicate whether manageablelocal storage is supported.1 0/7 Indicate whether manageable
localstorage_seamless0 0/7 Indicate whether seamlessrecording is supported.0 0/7 Indicate whether seamless
localstorage_modnum0,0 0/7 The maximum MOD connection numbers.0,0 0/7 The maximum MOD connection numbers.
adaptiverecording1 0/7 Indicate whether to supportadaptive recording.1 0/7 Indicate whether to support adaptive recording.
adaptivestreaming1 0/7 Indicate whether to supportadaptive streaming.1 0/7 Indicate whether to support adaptive streaming.

7.24 Customized event script

Group: event_customtaskfile_i<0\~2>

PARAMETER VALUEDEFAULT SECURITY(get/set)DESCRIPTION
namestring[40]6/6Custom script identification of this entry.
datestring[4~20]6/6Date of custom script.
timestring[4~20]6/6Time of custom script.

7.25 Event setting

Group: event_i<0\~2>

PARAMETERVALUEDEFAULTSECURITY (get/set)DESCRIPTION
namestring[40]6/6Identification of this entry.
enable0, 106/6Enable or disable this event.
priority0, 1, 216/6Indicate the priority of this event: “0” = low priority“1” = normal priority“2” = high priority
delay 1~999 20 6/6 Delay in seconds beforedetecting thenext event.
triggerboot,di,motion,seq,recnotify,tampering,vi,boot 6/6 Indicate the trigger condition:“boot” = System boot“di”= Digital input“motion” = Video motion detection“seq” = Periodic condition“recnotify” = Recording notification.“tampering” = Tamper detection.“vi”= Virtual input (Manual trigger)
triggerstatus string[40] trigger 6/6 The status for event trigger
di 0~3 1 6/6 Indicate the source id of di trigger.This field is required when trigger condition is “di”.One bit represents one digital input.The LSB indicates DI 0.
vi 0~7 0 6/6 Indicate the source id of vi trigger.This field is required when trigger condition is “vi”.One bit represents one digital input.The LSB indicates VI 0.
mdwin 0,1,20 6/6 Indicate the source window id ofmotion detection.This field is required when trigger condition is “md”.One bit represents one window.The LSB indicates the 1^st window.For example, to detect the 1^st and 3^rd windows, set mdwin as 5.
mdwin00 6/6 Similar to mdwin.The parameter takes effect when profile 1 of motion detection is enabled.
inter1~999 1 6/6 Interval of snapshots in minutes.This field is used when trigger condition is “seq”.
weekday 0~127 127 6/6Indicate which weekday is scheduled.One bit represents one weekday.bit0 (LSB) = Saturdaybit1 = Fridaybit2 = Thursdaybit3 = Wednesdaybit4 = Tuesdaybit5 = Mondaybit6 = SundayFor example, to detect events onFriday and Sunday, set weekday as66.
begintime hh:mm 00:006/6 Begin time of the weekly schedule.
endtime hh:mm 24:00 6/6 End time of the w eekly schedule.(00:00 ~ 24:00 sets schedule asalways on)
action_cf_enable 0,1 0 6/6 Enable media write on CF or otherlocal storage media
action_cf_folder string[128]6/6 Path to store media.
action_cf_mediaNULL, 0~4,1016/6Index of the attached media.
action_cf_datefolder16/6Enable this to create folders by date,time, and hour automatically.
action_cf_backup0 6/6 Enable the capability of backing uprecorded files to the SD card whennetwork is lost.0: Disabled1: Enabled
action_server_i<0~4>_en able0,10 6/6 Enable or disable this server action.
action_server_i<0~4>_media0~4, 1016/6 Index of the attached media.
action_server_i<0~4>_datefolder0 6/6 Enable this to create folders by date,time, and hour automatically.

7.26 Server setting for event action

Group: server_i<0\~4>

PARAMETER VALUEDEFAULT SECURITY(get/set)DESCRIPTION
name string[40]6/6 Identification of this entry
typeemail,ftp,http,nsemail 6/6 Indicate the server type:“email” = email server“ftp” = FTP server“http” = HTTP server“ns” = network storage
http_url string[128] http:// 6/6 URL of the HTTP server to upload.
http_usernamestring[64]6/6Username to log in to the server.
http_passwdstring[64] <blank> 6/6 Password of the user.
ftp_addressstring[128] <blank> 6/6 FTP server address.
ftp_usernamestring[64]6/6Username to log in to the server.
ftp_passwdstring[64] <blank> 6/6 Password of the user.
ftp_port0~65535216/6Port to connect to the server.
ftp_locationstring[128] <blank> 6/6 Location to upload or store the media.
ftp_passive0, 116/6Enable or disable passive mode.0 = disable passive mode1 = enable passive mode
email_addressstring[128]6/6Email server address.
email_sslmode0, 106/6Enable support SSL.
email_port0~65535256/6Port to connect to the server.
email_usernamestring[64]6/6Username to log in to the server.
email_passwdstring[64]6/6Password of the user.
email_senderemailstring[128]6/6Email address of the sender.
email_recipientemailstring[128] <blank> 6/6 Email address of the recipient.
ns_locationstring[128] <blank> 6/6 Location to upload or store the media.
ns_usernamestring[64]6/6Username to log in to the server.
ns_passwdstring[64]6/6Password of the user.
ns_workgroup string[64]<blank> 6/6 Workgroup for network storage.

7.27 Media setting for event action

Group: media_i<0\~4>

PARAMETER VALUEDEFAULT SECURITY(get/set)DESCRIPTION
name string[40]6/6 Identification of this entry
typesnapshot,systemlog,videoclip,recordmsgsnapshot 6/6Media type to send to the server orstore on the server.
snapshot_source 0,1 0 6/6Indicate the source of media stream.0 means the first stream.1 means the second stream and etc.2 means the third stream and etc.3 means the fourth stream and etc.
snapshot_prefixstring[16]6/6 Indicate the prefix of the filename.
snapshot_datesuffix0, 106/6Add date and time suffix to filename:1 = Add date and time suffix.0 = Do not add.
snapshot_preevent 0 ~ 71 6/6Indicates the number of pre-event images.
snapshot_postevent0 ~ 716/6The number of post-event images.
videoclip_source0,1 0 6/6 Indicate the source of media stream.0 means the first stream.1 means the second stream and etc.2 means the third stream and etc.3 means the fourth stream and etc.
videoclip_prefix string[16]6/6Indicate the prefix of the filename.
videoclip_preevent0 ~ 906/6Indicates the time for pre-event recording in seconds.
videoclip_maxduration1 ~ 2056/6Maximum duration of one video clip in seconds.
videoclip_maxsize50 ~ 40965006/6Maximum size of one video clip file in Kbytes.

7.28 Recording

Group: recording_i<0\~1>

PARAMETER VALUEDEFAULT SECURITY(get/set)DESCRIPTION
name string[40]6/6 Identification of this entry.
enable 0, 1 0 6/6 Enable or disable this recording.
priority0~21 6/6 Indicatethe priority ofthisrecording:“0” indicates low priority.“1” indicates normal priority.“2” indicates high priority.
source 0,10 6/6 Indicate the source of mediastream.0 means the first stream.1 means the second stream and so on.
limitsize 0,10 6/6 0: Entirefree space mechanism1: Limit recording size mechanism
cyclic0,10 6/6 0: Disable cyclic recording1: Enable cyclic recording
notify0,11 6/6 0: Disable recording notification1: Enable recording notification
notifyserver0~310 6/6 Indicatewhich notification server is scheduled.One bit represents one application server (server_i0~i4).bit0 (LSB) = server_i0.bit1 = server_i1.bit2 = server_i2.bit3 = server_i3.bit4 = server_i4.For example, enable server_i0, server_i2, and server_i4 as notification servers; the notifyserver value is 21.
weekday 0~127 127 6/6Indicate which weekday isscheduled.One bit represents one weekday.bit0 (LSB) = Saturdaybit1 = Fridaybit2 = Thursdaybit3 = Wednesdaybit4 = Tuesdaybit5 = Mondaybit6 = SundayFor example, to detect events onFriday and Sunday, set weekday as66.
begintime hh:mm 00:006/6 Start time of the weekly schedule.
endtime hh:mm 24:00 6/6 End time of the weekly schedule.(00:00~24:00 indicates schedulealways on)
prefix string[16]6/6 Indicate the prefix of the filename.
cyclesize 100~ 100 6/6The maximum size for cyclerecording in Kbytes whenchoosing to limit recording size.
reserveamount 0~ 100 6/6 The reserved amount in Mbyteswhen choosing cyclic recordingmechanism.
destcf,0,1,2,3,4cf6/6 The destination to store therecorded data.“cf” means local storage (CF orSD card).“0” means the index of thenetwork storage.
cffolderstring[128]6/6 Folder name.
maxsize100~2000100 6/6 Unit:Mega bytes.When this condition is reached,recording file is truncated.
maxduration60~3600606/6 Uuit: MinuteWhen this condition is reached,recording file is truncated.
triggerschedule, networkfailschedule 6/6The event trigger type schedule: The event is triggered by schedule networkfail: The event is triggered by the failure of network connection.
adaptive_enable0,106/6 Indicate whether the recording is enabled
adaptive_preevent 0~9 56/6 Indicate when is the adaptiverecording started before the event trigger point (seconds)
adaptive_postevent 0~105 6/6 Indicate when is the adaptiverecording stopped after the event trigger point (seconds)

7.29 HTTPS

Group: https

NAME VALUE DEFAULT SECURITY(get/set)DESCRIPTION
enable06/6To enable or disable secure HTTP.
policy06/6If the value is 1, it will force HTTP connection redirect to HTTPS connection
methodauto, manual, installauto6/6auto => Create self-signed certificate automatically. manual => Create self-signed certificate manually. install => Create certificate request and install.
status-3 ~ 106/6Specify the https status. -3 = Certificate not installed -2 = Invalid public key -1 = Waiting for certificate 0 = Not installed 1 = Active
countrynamestring[2]TW6/6Country name in the certificate information.
stateorprovincenamestring[128] Asia 6/6State or province name in the certificate information.
localitynamestring[128]Asia6/6 The locality name in the certificate information.
organizationnamestring[64]VIVOTEK Inc.6/6 Organization name in the certificate information.
unitstring[32]VIVOTEK Inc.6/6 Organizational unit name in the certificate information.
commonnamestring[64]www.vivotek.com6/6 Common name in the certificate information.
validdays 0 ~ 3650 3650 6/6 Valid periodfor the

7.30 Storage management setting

Currently it's for local storage (SD card)

Group: disk_i<0\~(n-1)> n is the total number of storage devices.

PARAMETERVALUEDEFAULTSECURITY (get/set)DESCRIPTION
cyclic_enabled06/6Enable cyclic storage method.
autocleanup_enabled06/6Enable automatic clean up method.Expired and not locked media files will be deleted.
autocleanup_maxage76/6To specify the expired days for automatic clean up.

7.31 Region of interest

Group: roi_c<0\~(n-1)> for n channel product, and m is the number of streams which support ROI.

PARAMETERVALUEDEFAULTSECURITY (get/set)DESCRIPTION
s<0~(m-1)>_home"0~1744","0~936"0,0 1/6ROI left-topcorner coordinate.
s<0~(m-1)>_size"176~1920"x"144~1080"1920x10801/6ROI width and height. The width value must be multiples of 16 and the height value must be multiples of 8

7.32 ePTZ setting

Group: eptz_c<0\~(n-1)> for n channel product.

PARAMETER VALUEDEFAULT SECURITY(get/set)DESCRIPTION
osdzoom1 1/4 Indicates multiple of zoom in is“on-screen display” or not
smooth1 1/4 Enable the ePTZ "move smoothly"feature
tiltspeed -5 ~ 5 0 1/7 Tilt speed(It should be set by eCamCtrl.cgi rather than by setparam.cgi.)
panspeed -5 ~ 5 0 1/7 Pan speed(It should be set by eCamCtrl.cgi rather than by setparam.cgi.)
zoomspeed-5 ~ 5 0 1/7 Zoom speed(It should be set by eCamCtrl.cgi rather than by setparam.cgi.)
autospeed1 ~ 51 1/7 Auto pan/patrol speed(It should be set by eCamCtrl.cgi rather than by setparam.cgi.)

Group: eptz_c<0\~(n-1)>_s<0\~(m-1)> for n channel product and m is the number of streams which support ePTZ.

PARAMETER VALUEDEFAULT SECURITY(get/set)DESCRIPTION
patrolseqstring[120]1/4The patrol sequence of ePTZ. All the patrol position indexes will be separated by ","
patroldwellingstring[160]1/4The dwelling time (unit: second) of each patrol point, separated by “,”.
preset_i<0~19>_namestring[40]1/7Name of ePTZ preset.(It should be set by ePreset.cgi rather than by setparam.cgi.)
preset_i<0~19>_pos1/7Left-top corner coordinate of the preset.(It should be set by ePreset.cgi rather than by setparam.cgi.)
preset_i<0~19>_size1/7 Widthand height ofthe preset.(It should be set by ePreset.cgi rather than by setparam.cgi.)

8. Useful Functions

8.1 Query Status of the Digital Input

Note: This request requires Viewer privileges

Method: GET/POST

Syntax:

http://<servername>/cgi-bin/dido/getdi.cgi?[di0][&di1][&di2][&di3] 

If no parameter is specified, all of the digital input statuses will be returned.

Return:

HTTP/1.0 200 OK\r\n

Content-Type: text/plain\r\n

Content-Length: \r\n

\r\n

[di0=] \r\n

[di1=] \r\n

[di2=] |r|n

[di3=] \r\n

where can be 0 or 1.

Example: Query the status of digital input 0.

Request:

http://myserver/cgi-bin/dido/getdi.cgi?di1 

Response:

HTTP/1.0 200 OK\r\n

Content-Type: text/plain\r\n

Content-Length: 7\r\n

\r\n

di0=1\r\n 

8.2 Capture Single Snapshot

Note: This request requires Normal User privileges.

Method: GET/POST

Syntax:

http://<servername>/cgi-bin/viewer/video.jpg?[channel=<value>][&resolution=<value>][&quality=<value>][&streamid=<value>] 

If the user requests a size larger than all stream settings on the server, this request will fail.

PARAMETERVALUE DESCRIPTION
channel 0~(n-1)The channelnumber of the video source.
resolutionThe resolution of the image.
quality 1~5The quality of the image.
streamid 0~(m-1)The stream number.

The server will return the most up-to-date snapshot of the selected channel and stream in JPEG format. The size and quality of the image will be set according to the video settings on the server.

Return:

HTTP/1.0 200 OK\r\n
Content-Type: image/jpeg\r\n
[Content-Length: <image size>\r\n]
<binary JPEG image data> 

8.3 Account Management

Note: This request requires Administrator privileges.

Method: GET/POST

Syntax:

http://<servername>/cgi-bin/admin/editaccount.cgi? method=<value>&username=<name>[&userpass=<value>][&privilege=<value>][&privilege=<value>][...][&return=<return page>] 
PARAMETER VALUE DESCRIPTION
method Add Addan account to the server. When using this method, the “username” field is necessary. It will use the default value of other fields if not specified.
Delete Remove an account from the server. When using this method, the “username” field is necessary, and others are ignored.
edit Modify the account password and privilege. When using this method, the “username” field is necessary, and other fields are optional. If not specified, it will keep the original settings.
usernameThe name of the user to add, delete, or edit.
userpassThe password of the new user to add or that of the old user to modify. The default value is an empty string.
PrivilegeThe privilege of the user to add or to modify.
viewerViewer privilege.
operatorOperator privilege.
adminAdministrator privilege.
ReturnRedirect to the pageafter the parameter is assigned. Thecan be a full URL path or relative path according to the current path. If you omit this parameter, it will redirect to an empty page.

8.4 System Logs

Note: This request require Administrator privileges.

Method: GET/POST

Syntax:

http://<servername>/cgi-bin/admin/syslog.cgi 

Server will return the most up-to-date system log.

Return:

HTTP/1.0 200 OK\r\n

Content-Type: text/plain\r\n

Content-Length: \r\n

\r\n

<system log information>\r\n 

8.5 Upgrade Firmware

Note: This request requires Administrator privileges.

Method: POST

Syntax:

http://<servername>/cgi-bin/admin/upgrade.cgi 

Post data:

fimage=[&return=]\r\n

\r\n

<multipart encoded form data> 

Server will accept the file named to upgrade the firmware and return with if indicated.

8.6 ePTZ Camera Control

Note: This request requires camctrl privileges.

Method: GET/POST

Syntax:

http://<servername>/cgi-bin/camctrl/eCamCtrl.cgi?channel=<value>&stream=<value>
[&move=<value>] - Move home, up, down, left, right
[&auto=<value>] - Auto pan, patrol
[&zoom=<value>] - Zoom in, out
[&zooming=<value>&zs=<value>] - Zoom without stopping, used for joystick
[&vx=<value>&vy=<value>&vs=<value>] - Shift without stopping, used for joystick
[&x=<value>&y=<value>&videosize=<value>&resolution=<value>&stretch=<value>] - Click on image
(Move the center of image to the coordination (x,y) based on resolution or videosize.)
[ [&speedpan=<value>][&speedtilt=<value>][&speedzoom=<value>][&speedapp=<value>] ] - Set speeds
[&return=<return page>] 

Example:

http://myserver/cgi-bin/camctrl/eCamCtrl.cgi?channel=0&stream=0&move=right
http://myserver/cgi-bin/camctrl/eCamCtrl.cgi?channel=0&stream=1&vx=2&vy=2&vz=2
http://myserver/cgi-bin/camctrl/eCamCtrl.cgi?channel=0&stream=1&x=100&y=100&videosize=640x480&resolution=640x480&stretch=0 
PARAMETER VALUE DESCRIPTION
channel <0~(n-1)> Channel of video source.
stream<0~(m-1)>Stream.
move home Move to home ROI.
autopanAuto pan.
patrolAuto patrol.
stopStop auto pan/patrol.
zoom wideZoom larger view with current speed.
tele Zoom further withcurrent speed.
zooming wide ortele Zoom without stoppping for larger view or further view with zs speed, used for joystick control.
zs 0~6 Set the speed of zooming, “0” means stop.
vxThe direction of movement, used for joystick control.
vy
vs 0~7 Set the speed of movement, “0” means stop.
xx-coordinate clicked by user.It will be the x-coordinate of center after movement.
yy-coordinate clicked by user.It will be the y-coordinate of center after movement.
videosizeThe size of plug-in (ActiveX) window in web page
resolutionThe resolution of streaming.
stretch0 indicates that it usesresolution(streaming size) as the range of the coordinate system.1 indicates that it usesvideosize(plug-in size) as the range of the coordinate system.
speedpan -5~5Set thepan speed.
speedtilt-5~5Set the tilt speed.
speedzoom-5~5Set the zoom speed.
speedapp 1~5 Set the auto pan/patrol speed.
returnRedirect to the pageafter the parameter is assigned. Thecan be a full URL path or relative path according to the current path.

8.7 ePTZ Recall

Note: This request requires camctrl privileges.

Method: GET/POST

Syntax:

http://<servername>/cgi-bin/camctrl/eRecall.cgi?channel=<value>&stream=<value>&recall=<value>[&return=<return page>] 
PARAMETER VALUE DESCRIPTION
channel <0~(n-1)> Channel of the video source.
stream<0~(m-1)>Stream.
recall Text stringless than 40 charactersOne of the present positions to recall.
returnRedirect to the pageafter the parameter is assigned. Thecan be a full URL path or relative path according to the current path.

8.8 ePTZ Preset Locations

Note: This request requires Operator privileges.

Method: GET/POST

Syntax:

http://<servername>/cgi-bin/operator/ePreset.cgi?channel=<value>&stream=<value>[&addpos=<value>][&delpos=<value>][&return=<return page>] 
PARAMETER VALUE DESCRIPTION
channel <0~(n-1)> Channel of the video source.
stream<0~(m-1)>Stream.
addposing less than 40 characters>Add one preset location to the preset list.
delposing less than 40 characters>Delete preset location from the preset list.
returnRedirect to the pageafter the parameter is assigned. Thecan be a full URL path orrelative path according to the current path.

8.9 IP Filtering

Note: This request requires Administrator access privileges.

Method: GET/POST

Syntax:

http://<servername>/cgi-bin/admin/ipfilter.cgi? method=<value>&[start=<ipaddress>&end=<ipaddress>][&index=<value>][&return=<return page>] 
PARAMETER VALUE DESCRIPTION
method addallowAdd allowed IP addressress range to the server. Start and end parameters must be specified. If the index parameter is specified, it will try to add starting from the index position.
adddeny Add denied IP address range to the server. Start and end parameters must be specified. If the index parameter is specified, it will try to add starting from the index position.
deleteallow Remove allowed IP address range from server. If start and end parameters are specified, it will try to remove the matched IP address. If index is specified, it will try to remove the address from given index position. [start, end] parameters have higher priority then the [index] parameter.
deletedeny Remove denied IP address range from server. If start and end parameters are specified, it will try to remove the matched IP address. If index is specified, it will try to remove the address from given index position. [start, end] parameters have higher priority then the [index] parameter.
startThe starting IP address to add or to delete.
endThe ending IP address to add or to delete.
indexThe start position to add or to delete.
returnRedirect to the pageafter the parameter is assigned. Thecan be a full URL path or relative path according to the current path. If you omit this parameter, it will redirect to an empty page.

8.9.1 IP Filtering for ONVIF

Syntax:

http://cgi-bin/admin/ipfilter.cgi?type[=]http://cgi-bin/admin/ipfilter.cgi?method=add&ip=[&index=&return=]http://cgi-bin/admin/ipfilter.cgi?method=del&index=[&return=]
PARAMETERVALUE DESCRIPTION
type NULL GetIP filter type
allow, deny Set IP filter type
method addv4Add IPv4 address into access list.
addv6 Add IPv6 address into access list.
delv4 Delete IPv4 address from access list.
delv6 Delete IPv6 address from access list.
ipSingle address:Network address:Range address:
indexThe start position to add or to delete.
returnRedirect to the pageafter the parameter is assigned. Thecan be a full URL path or relative path according to the current path. If you omit this parameter, it will redirect to an empty page.

8.10 Event/Control HTTP Tunnel Channel

Note: This request requires Administrator privileges.

Method: GET and POST

Syntax:

http:///cgi-bin/admin/ctrlevent.cgi
----
GET /cgi-bin/admin/ctrlevent.cgi
x-sessioncookie: string[22]
accept: application/x-vvtk-tunnelled
pragma: no-cache
cache-control: no-cache
POST /cgi-bin/admin/ ctrlevent.cgi
x-sessioncookie: string[22]
content-type: application/x-vvtk-tunnelled
pragma : no-cache
cache-control : no-cache
content-length: 32767
expires: Sun, 9 Jam 1972 00:00:00 GMT 

User must use GET and POST to establish two channels for downstream and upstream. The x-sessioncookie in GET and POST should be the same to be recognized as a pair for one session. The contents of upstream should be base64 encoded to be able to pass through the proxy server.

This channel will help perform real-time event subscription and notification as well as camera control more efficiently. The event and control formats are described in another document.

See Event/control tunnel spec for detail information

8.11 Get SDP of Streams

Note: This request requires Viewer access privileges.

Method: GET

Syntax:

http://<servername>/<network_rtsp_s<0~m-1>_accessname> 

“m” is the stream number.

“network_accessname_<0\~(m-1)>” is the accessname for stream “1” to stream “m”. Please refer to the “subgroup of network: rtsp” for setting the accessname of SDP.

You can get the SDP by HTTP GET.

When using scalable multicast, Get SDP file which contains the multicast information via HTTP.

8.12 Open the Network Stream

Note: This request requires Viewer access privileges.

Syntax:

For HTTP push server (MJPEG):

http://<servername>/<network_http_s<0~m-1>_accessname> 

For RTSP (MP4), the user needs to input the URL below into an RTSP compatible player.

rtsp://<servername>/<network_rtsp_s<0~m-1>_accessname> 

“m” is the stream number.

For details on streaming protocol, please refer to the "control signaling" and "data format" documents.

8.13 Storage managements (capability.storage.dbenabled > 0)

Note: This request requires administrator privileges.

Method: GET and POST

Syntax:

http://<servername>/cgi-bin/admin/lsctrl.cgi?cmd=<cmd_type>[&<parameter>=<value>...] 

The commands usage and their input arguments are as follows.

PARAMETER VALUE DESCRIPTION
cmd_typeRequired.Command to be executed, including search, insert, delete, update, and queryStatus.

Command: search

PARAMETER VALUE DESCRIPTION
labelOptional.The integer primary key column will automatically be assigned a unique integer.
triggerTypeOptional.Indicate the event trigger type.Please embrace your input value with single quotes.Ex. mediaType='motion'Support trigger types are product dependent.
mediaTypeOptional.Indicate the file media type.Please embrace your input value with single quotes.Ex. mediaType='videoclip'Support trigger types are product dependent.
destPathOptional.Indicate the file location in camera.Please embrace your input value with single quotes.Ex. destPath='/mnt/auto/CF/NCMF/abc.mp4'
resolutionOptional.Indicate the media file resolution.Please embrace your input value with single quotes.Ex. resolution='800x600'
isLockedOptional.Indicate if the file is locked or not.0: file is not locked.1: file is locked.A locked file would not be removed from UI or cyclic storage.
triggerTimeOptional.Indicate the event trigger time. (not the file created time)Format is "YYYY-MM-DD HH:MM:SS"Please embrace your input value with single quotes.Ex. triggerTime='2008-01-01 00:00:00'If you want to search for a time period, please apply "TO" operation.Ex. triggerTime='2008-01-01 00:00:00'+TO+'2008-01-01 23:59:59' is to search for records from the start of Jan 1^st 2008 to the end of Jan 1^st 2008.
limitOptional.Limit the maximum number of returned search records.
offsetOptional.Specifies how many rows to skip at the beginning of the matched records.Note that the offset keyword is used after limit keyword.

To increase the flexibility of search command, you may use “OR” connectors for logical “OR” search operations. Moreover, to search for a specific time period, you can use “TO” connector.

Ex. To search records triggered by motion or di or sequential and also triggered between 2008-01-01 00:00:00 and 2008-01-01 23:59:59.

http://<servername>/cgi-bin/admin/lsctrl.cgi?cmd=search&triggerType='motion'+OR+'di'+OR+'seq' &triggerTime='2008-01-01 00:00:00'+TO+'2008-01-01 23:59:59' 

Command: delete

PARAMETER VALUE DESCRIPTION
labelRequired.Identify the designated record.Ex. label=1

Ex. Delete records whose key numbers are 1, 4, and 8.

http://<servername>/cgi-bin/admin/lsctrl.cgi?cmd=delete&label=1&label=4&label=8 

Command: update

PARAMETER VALUE DESCRIPTION
labelRequired.Identify the designated record.Ex. label=1
isLockedRequired.Indicate if the file is locked or not.

Ex. Update records whose key numbers are 1 and 5 to be locked status.

http://<servername>/cgi-bin/admin/lsctrl.cgi?cmd=update&isLocked=1&label=1&label=5 

Ex. Update records whose key numbers are 2 and 3 to be unlocked status.

http://<servername>/cgi-bin/admin/lsctrl.cgi?cmd=update&isLocked=0&label=2&label=3 

8.13.1 Return Message

The returned results are always in XML format, except for storage status related elements that can be returned in javascript format. (i.e. status, totalSize,_freeSize, and usefulness.)

The elements are listed as follows.

Group: stormgr

Element name Type Description
countsInteger> Total number of matched records.
limitLimit the maximum number of returned search records.Could be empty if not specified.
offsetInteger> Specifies how many rows to skip at the beginning of the matched records.Could be empty if not specified.
statusCodeThe reply status (see table below)
statusString string Return string describing the reason that status code is not OK.

Subgroup of stormgr: i<0\~(n-1)>: n is the total number of displayed records.

Element name Type Description
labelA unique integer.
triggerTypeIndicate the event trigger type.
mediaTypeIndicate the file media type.
destPathIndicate the file location in camera.
resolutionIndicate the media file resolution.
isLockedIndicate if the file is locked or not.
triggerTimeIndicate the event trigger time.Format is “YYYY-MM-DD HH:MM:SS”
backupIndicate if the file is generated when network loss.

Subgroup of stormgr_disk: i<0\~(n-1)>: n is the total number of storage devices.

Element name Type Description
namestring Description of sppecified storage device.
status ready, detached, error,and readonlyThe storage device status.ready: storage is ready for access.detached: storage is not mounted.error: failed to open storage device.readonly: storage is write protected.
totalSizeTheoverall storage size in kilobytes.
freeSizeTheavailable storage size in kilobytes.
usedSizeThe used storage size in kilobytes.

path string Location of database of storage sink

Ex. Returned results of search command

<?xml version="1.0" encoding="ISO-8859-1" ?>
<stormgr version="0.0.0.1">
    <counts>5</counts>
    <limit>2</limit>
    <offset>0</offset>
    <i0>
    <label>1</label>
    <triggerType>motion</triggerType>
    <mediaType>videoclip</mediaType>
    <destPath>/mnt/auto/NCMF/abc/abc.jpg</destPath>
    <resolution>800x600</resolution>
    <isLocked>0</isLocked>
    <triggerTime>2009-01-24 12:00:00</triggerTime>
    <backup>0</backup>
    </i0>
    <i1>
    <label>2</label>
    <triggerType>di</triggerType>
    <mediaType>snapshot</mediaType>
    <destPath>/mnt/auto/NCMF/123/123.jpg</destPath>
    <resolution>800x600</resolution>
    <isLocked>0</isLocked>
    <triggerTime>2009-01-24 12:01:00</triggerTime>
    <backup>0</backup>
    </i1>
</stormgr> 

Ex. Local storage status in XML format.

<?xml version="1.0" encoding="ISO-8859-1" ?>
<stormgr version="0.0.0.1">
    <disk>
    <i0>
    <name>SDcard</name>
    <status>ready</status>
    <totalSize>7824444</totalSize>
    <freeSize>7824388</freeSize>
    </disk>
</stormgr> 
56
Ex. Local storage status in javascript format.
disk_i0_name='SDcard'disk_i0_status='ready'disk_i0_totalSize='7824444'disk_i0_freeSize='7824388'disk_i0_usedSize='56'disk_i0_path=i0/NCMF/.db/.localStorage.db
Command: queryStatus
PARAMETER VALUE DESCRIPTION
retType xml or javascript Optional.Ex. retype=javascriptThe default return message is in XML format.
Ex. Query local storage status and call for javascript format return message.
http:///cgi-bin/admin/lsctrl.cgi?cmd=queryStatus&retType=javascript
There are two cgi commands for download and composing jpegs to avi format.For download single selected file, you can use "/cgi-bin/admin/downloadMedias.cgi". Just assign the request file path to this cgi.
Syntax:
http://cgi-bin/admin/downloadMedias.cgi?
Theis in querystus return message.
Ex.
http://cgi-bin/admin/downloadMedias.cgi?/mnt/auto/CF/NCMF/20090310/07/02.mp4
For creating an AVI file by giving a list of JPEG files, you can use "/cgi-bin/admin/jpegtoavi.cgi".
Syntax:
http://<servername>/cgi-bin/admin/jpegtoavi.cgi?<resolution>=<width>x<height>&<fps>=<num>&<list>=<fileList> 
PARAMETER VALUE DESCRIPTION
resolutionxResolution
fpsFrame rate
listThe JPEG file list.The file path should be embraced by single quotation marks

Ex.

http:// <servername>/cgi-bin/admin/
jpegtoavi.cgi?resolution=800x600&fps=1&list='/mnt/auto/CF/NCMF/video1650.jpg', '/mnt/auto/CF/NCMF/video1651.jpg', '/mnt/auto/CF/NCMF/video1652.jpg', 

8.14 Virtual input

Note: Change virtual input (manual trigger) status.

Method: GET/POST

Syntax:

http://<servername>/cgi-bin/admin/setvi.cgi?vi0=<value>[&vi1=<value>][&vi2=<value>][&return=<return page>] 
PARAMETERVALUEDESCRIPTION
vistate[(duration)nstate]Where "state" is 0, 1. “0” means inactive or normal state while “1” means active or triggered state.Where "nstate" is next state after duration.Ex: vi0=1Setting virtual input 0 to trigger state
Ex: vi0=0(200)1Setting virtual input 0 to normal state, waiting 200 milliseconds, setting it to trigger state.Note that when the virtual input is waiting for next state, it cannot accept new requests.
returnRedirect to the pageafter therequest is completely assigned. Thepage> can be a full URL path or relative path according the current path. If you omit this parameter, it will redirect to an empty page.
Return Code Description
200 The request is successfully executed.
400 The request cannot be assigned, ex. incorrect parameters.Examples:1. setvi.cgi?vi0=0(10000)1(15000)0(20000)1No multiple duration.2. setvi.cgi?vi3=0VI index is out of range.3. setvi.cgi?vi=1No VI index is specified.
503 The resource is unavailable, ex. Virtual input is waiting for next state.Examples:1. setvi.cgi?vi0=0(15000)12. setvi.cgi?vi0=1Request 2 will not be accepted during the execution time(15 seconds).

8.15 Open Timeshift Stream

Note: This request requires Viewer access privileges.

Syntax:

For HTTP push server (MJPEG):

http:///\_accessname>?maxsft=[&tsmode=&reftime=&forcechk&minsft=]

For RTSP (MP4 and H264), the user needs to input the URL below into an RTSP compatible player.

rtsp:///\_accessname>?maxsft=[&tsmode=&reftime=&forcechk&minsft=]

“n” is the channel index.

“m” is the timeshift stream index.

For details on timeshift stream, please refer to the “TimeshiftCaching” documents.

PARAMETER VALUE DEFAULT DESCRIPTION

maxsft<positive integer>0 Request cached stream at most how many seconds ago.
tsmodenormal, adaptivenormal Streaming mode: normal => Full FPS all the time. adaptive => Default send only I-frame for MP4 and H.264, and send 1 FPS for MJPEG. If DI or motion window are triggered, the streaming is changed to send full FPS for 10 seconds. (*Note: this parameter also works on non-timeshift streams.)
reftime mm:ss The timeReference time for maxsft and minsft. camera (This provides more precise time control to eliminate receives the request. Ex: Request the streaming from 12:20 rtsp://10.0.0.1/live.sdp?maxsft=10&reftime=12:30

forcechk N/A N/A Check if the requested stream enables timeshift, feature and if minsft is achievable. If false, return “415 Unsupported Media Type”.

minsft 0 How many seconds of cached stream client can accept at least.

(Used by forcechk)
Return Code Description
400 Bad Request Request is rejected because some parameter values are illegal.
415 Unsupported Media TypeReturned, if forcechk appears, when minsft is not achievable or the timeshift feature of the target stream is not enabled.

8.16 Open Anystream

Note: This request requires Viewer access privileges.

Syntax:

For HTTP push server (MJPEG):

http://<servername>/videoany.mjpg?codectype=mjpeg[&resolution=<value>&mjpeg_quant=<value>&mjpeg_qvalue=<value>&mjpeg_maxframe=<value>] 

For RTSP (H264), the user needs to input the URL below into an RTSP compatible player.

rtsp://<servername>/liveany.sdp?codectype=h264[&resolution=<value>&h264_intraperiod=<value>& h264_ratecontrolmode=<value>& h264_quant=<value>& h264_qvalue=<value>& h264_bitrate=<value>& h264_maxframe=<value>] 
PARAMETER VALUEDESCRIPTION
codectype mjpeg, h264Set codec type for Anystream.
solution capability_videooin_resolution Video resolution in pixels.
mjpeg_quant 99, 1~5Quality ofJPEG video.99 is the customized manual input setting.1 = worst quality, 5 = best quality.
mjpeg_qvalue10~200Manual videoeo quality level input.(This must be present if mjpeg_quant is equal to 99)
mjpeg_maxframe1~25,26~30 (only for 60Hz CMOS)Set maximum frame rate in fps(for JPEG).
h264_intraperiod250, 500, 1000, 2000, 3000, 4000Intra frameperiod in milliseconds.
h264_ratecontrolmode cbr, vbr cbr: constant bitratevbr: fix quality
h264_quant 99, 1~5 Quality of video when choosingvbr in “h264_ratecontrolmode”.99 is the customized manual input setting.1 = worst quality, 5 = best quality.
h264_qvalue 0~51 Manual video quality levelinput.(This must be present if h264_quant is equal to 99)
h264_bitrate 1000~8000000 Set bit rate in bps whenchoosing cbr in “h264_ratecontrolmode”.
h264_maxframe 1~25,26~30 (only for 60Hz CMOS)Set maximum frame rate in fps(for H264).

8.17 Export Files

Note: This request requires Administrator privileges.

Method: GET

Syntax:

For daylight saving time configuration file:

http:///cgi-bin/admin/exportDst.cgi

For language file:

http:///cgi-bin/admin/export_language.cgi?currentlanguage=

PARAMETER VALUEDESCRIPTION
currentlanguage0~20Available language lists.Please refer to:system_info_language_i0 ~ system_info_language_i19.

For setting backup file:

http:///cgi-bin/admin/export_backup.cgi?backup

8.18 Upload Files

Note: This request requires Administrator privileges.

Method: POST

Syntax:

For daylight saving time configuration file:

http://<servername>/cgi-bin/admin/upload_dst.cgi 

Post data:

filename = <file name> \r\n
\r\n
<multipart encoded form data> 

For language file:

http://<servername>/cgi-bin/admin/upload_1an.cgi 

Post data:

filename = <file name> \r\n
\r\n
<multipart encoded form data> 

For setting backup file:

http://<servername>/cgi-bin/admin/upload_backup.cgi 

Post data:

filename = <file name> \r\n
\r\n
<multipart encoded form data> 

Server will accept the file named to upload this one to camera.

<End of document> 

Technical Specifications

Technical Specifications

ModelsFD8166-F2 (Lens f = 2.8mm)FD8166-F3 (Lens f = 3.6mm)FD8166-F6 (Lens f = 6mm)
System Information
CPUMultimedia SoC (System-on-Chip)
Flash16 MB
RAM256 MB
Camera Features
Image Sensor1/2.7" Progressive CMOS
Maximum Resolution1920x1080
Lens TypeFixed-focal
Focal Lengthf = 2.8 mm (FD8166-F2)f = 3.6 mm (FD8166-F3)f = 6 mm (FD8166-F6)
ApertureF2.0 (FD8166-F2)F1.8 (FD8166-F3)F1.6 (FD8166-F6)
Field of ViewFD8166-F2:121° (horizontal)68° (vertical)142° (diagonal)FD8166-F3:98° (horizontal)50° (vertical)111° (diagonal)FD8166-F656° (horizontal)31° (vertical)64° (diagonal)
Shutter Time1/5 sec. to 1/32,000 sec.
Minimum IlluminationFD8166-F2:0.24 Lux, 50 IREFD8166-F3:0.14 Lux, 50 IREFD8166-F60.18 Lux, 50 IRE
Pan Range45°
Tilt Range33° ~ 90°
PanVilt/zoomFunctionalitiesePTZ:48x digital zoom (4x on IE plug-in, 12x built-in)
On-board StorageMicroSD/SDHC/SDXC card slot
Video
CompressionH.264 & MJPEG
Maximum Frame RateH.264:15 fps at 1920x108030 fps at 1280x720MJPEG:15 fps at 1920x108030 fps at 1280x720
Maximum Streams2 simultaneous streams
S/N RatioAbove 53dB
Video StreamingAdjustable resolution, quality and bitrateConfigurable video cropping for bandwidth saving
Image SettingsAdjustable image size, quality and bit rateTime stamp, text overlay, flip & mirrorConfigurable brightness, contrast, saturation, sharpness, white balance, exposure control, gain, backlight compensation, privacy masksScheduled profile settings
Audio
Audio CapabilityAudio input
CompressionG.711
InterlaceBuilt-in microphone
Effective Range5 meters
Network
UsersLive viewing for up to 10 clients
ProtocolsIPv4, IPv6, TCP/IP, HTTP, HTTPS, UPnP, RTSP/RTP/RTCP, IGMP, SMTP, FTP, DHCP, NTP, DNS, DDNS, PPPoE, CoS, QoS, SNMP, 802.1X
Interface10Base-T/100 BaseTX Ethernet (RJ-45)
ONVIFSupported, specification available at www.onvif.org
Intelligent Video
Video Motion DetectionTriple-window video motion detection
Alarm and Event
Alarm TriggersVideo motion detection, manual trigger, digital input, periodical trigger, system boot, recording notification, camera tampering detection
Alarm EventsEvent notification using HTTP, SMTP, FTP and NAS serverFile upload via HTTP, SMTP, FTP and NAS server
General
ConnectorsRJ-45 for Network/PoE connectionDigital input*1
LED IndicatorSystem power and status indicator
Power InputIEEE 802.3af PoE Class 1
Power ConsumptionMax: 2.9W
Dimensions∅: 90 mm x 50 mm
WeightNet: 144g
Safety CertificationsCE, LVD, FCC Class B, VCCI, C-Tick
Operating Temperature0°C - 50°C (32°F - 122°F)
Warranty24 months
System Requirements
Operating SystemMicrosoft Windows 7/VistaXPI2000
Web BrowserMozilla Firefox 7-10 (streaming only)Internet Explorer 7.x or 8.x
Other PlayersVLC: 1.1.11 or aboveQuickTime: 7 or above
Included Accessories
CDUser's manual, quick installation guide, Installation Wizard 2, ST7501 32-channel recording software
OthersQuick installation guide, warranty card, screws pack, focus kit

Dimensions

Ø90 mm 23.3 mm 38.7 mm 50 mm

Compatible Accessories

PoE Kits

Vivotek FD8166-F6 - Compatible Accessories - 1

POE-IJ-1748NDN

802.3af Compliant PoE Injector

All specifications are subject to change without notice. Copyright © 2013 VIVOTEK INC. All rights reserved.

Distributed by:

Vivotek FD8166-F6 - Compatible Accessories - 2

VIVOTEK INC.

6F. No.192. Lien-Cheng Rd., Chung-Ho, New Taipei City, 235, Taiwan, R.O.C.

T: +886-2-82455782 | E: +886-2-82455537 | E: sales@vivntak.com

VIVOTEK USA, INC.

2050 Ringwood Avenue, San Jose, CA 95131

T: 408-773-8650 | F: 408-773-8298 | E: salesues@yivotek.com

Ver 1.0

Technology License Notice

MPEG-4 AAC Technology

THIS PRODUCT IS LICENSED UNDER THE MPEG-4 AAC AUDIO PATENT LICENSE. THIS PRODUCT MAY NOT BE DECOMPILED, REVERSE-ENGINEERED OR COPIED, EXCEPT WITH REGARD TO PC SOFTWARE, OF WHICH YOU MAY MAKE SINGLE COPIES FOR ARCHIVAL PURPOSES. FOR MORE INFORMATION, PLEASE REFER TO HTTP://WWW.VIALICENSING.COM.

MPEG-4 Visual Technology

THIS PRODUCT IS LICENSED UNDER THE MPEG-4 VISUAL PATENT PORTFOLIO LICENSE FOR THE PERSONAL AND NON-COMMERCIAL USE OF A CONSUMER FOR (i) ENCODING VIDEO IN COMPLIANCE WITH THE MPEG-4 VISUAL STANDARD ("MPEG-4 VIDEO") AND/OR (ii) DECODING MPEG-4 VIDEO THAT WAS ENCODED BY A CONSUMER ENGAGED IN A PERSONAL AND NON-COMMERCIAL ACTIVITY AND/OR WAS OBTAINED FROM A VIDEO PROVIDER LICENSED BY MPEG LA TO PROVIDE MPEG-4 VIDEO. NO LICENSE IS GRANTED OR SHALL BE IMPLIED FOR ANY OTHER USE. ADDITIONAL INFORMATION INCLUDING THAT RELATING TO PROMOTIONAL, INTERNAL AND COMMERCIAL USES AND LICENSING MAY BE OBTAINED FROM MPEG LA, LLC. PLEASE REFER TO HTTP://WWW.MPEGLA.COM.

AMR-NB Standard

THIS PRODUCT IS LICENSED UNDER THE AMR-NB STANDARD PATENT LICENSE AGREEMENT. WITH RESPECT TO THE USE OF THIS PRODUCT, THE FOLLOWING LICENSORS' PATENTS MAY APPLY:

TELEFONAKIEBOLAGET ERICSSON AB: US PAT. 6192335; 6275798; 6029125; 6424938; 6058359. NOKIA CORPORATION: US PAT. 5946651; 6199035. VOICEAGE CORPORATION: AT PAT. 0516621; BE PAT. 0516621; CA PAT. 2010830; CH PAT. 0516621; DE PAT. 0516621; DK PAT. 0516621; ES PAT. 0516621; FR PAT. 0516621; GB PAT. 0516621; GR PAT. 0516621; IT PAT. 0516621; LI PAT. 0516621; LU PAT. 0516621; NL PAT. 0516621; SE PAT 0516621; US PAT 5444816; AT PAT. 819303/AT E 198805T1; AU PAT. 697256; BE PAT. 819303; BR PAT. 9604838-7; CA PAT. 2216315; CH PAT. 819303; CN PAT. ZL96193827.7; DE PAT. 819303/DE69611607T2; DK PAT. 819303; ES PAT. 819303; EP PAT. 819303; FR PAT. 819303; GB PAT. 819303; IT PAT. 819303; JP PAT. APP. 8-529817; NL PAT. 819303; SE PAT. 819303; US PAT. 5664053. THE LIST MAY BE UPDATED FROM TIME TO TIME BY LICENSORS AND A CURRENT VERSION OF WHICH IS AVAILABLE ON LICENSOR'S WEBSITE AT HTTP://WWW.VOICEAGE.COM.

Electromagnetic Compatibility (EMC)

FCC Statement

This device compiles with FCC Rules Part 15. Operation is subject to the following two conditions.

■ This device may not cause harmful interference, and
■ This device must accept any interference received, including interference that may cause undesired operation.

This equipment has been tested and found to comply with the limits for a Class B digital device, pursuant to Part 15 of the FCC Rules. These limits are designed to provide reasonable protection against harmful interference in a residential installation. This equipment generates, uses and can radiate radio frequency energy and, if not installed and used in accordance with the instructions, may cause harmful interference to radio communications. However, there is no guarantee that interference will not occur in a partial installation. If this equipment does cause harmful interference to radio or television reception, which can be determined by turning the equipment off and on, the user is encouraged to try to correct the interference by one or more of the following measures:

■ Reorient or relocate the receiving antenna.
■ Increase the separation between the equipment and receiver.
■ Connect the equipment into an outlet on a circuit different from that to which the receiver is connected.
■ Consult the dealer or an experienced radio/TV technician for help.

Shielded interface cables must be used in order to comply with emission limits.

CE Mark Warning

This is a Class B product. In a domestic environment, this product may cause radio interference, in which case the user may be required to take adequate measures.

VCCI Warning

VIVOTEK Inc. cannot be held responsible for any technical or typographical errors and reserves the right to make changes to the product and manuals without prior notice. VIVOTEK Inc. makes no warranty of any kind with regard to the material contained within this document, including, but not limited to, the implied warranties of merchantability and fitness for any particular purpose.

Table of contents Click a title to access it
Manual assistant
Powered by Anthropic
Waiting for your message
Product information

Brand : Vivotek

Model : FD8166-F6

Category : Security Camera