Microchip

TSC695F - Electronic component Microchip - Free user manual and instructions

Find the device manual for free TSC695F Microchip in PDF.

📄 110 pages English EN Download 💬 AI Question
Notice Microchip TSC695F - page 6
Pick your language and provide your email: we'll send you a specifically translated version.

User questions about TSC695F Microchip

0 question about this device. Answer the ones you know or ask your own.

Ask a new question about this device

The email remains private: it is only used to notify you if someone responds to your question.

No questions yet. Be the first to ask one.

Download the instructions for your Electronic component in PDF format for free! Find your manual TSC695F - Microchip and take your electronic device back in hand. On this page are published all the documents necessary for the use of your device. TSC695F by Microchip.

USER MANUAL TSC695F Microchip

SPARC 32-bit Space Processor

User Manual

Table of Contents

Section 1

Features....1-1

1.1 Description....1-2
1.2 Block Diagram....1-2
1.3 Pin Description....1-2
1.4 System Architecture....1-5

Section 2

Architecture....2-7

2.1 The RISC Machine....2-7
2.2 The Characteristics of RISC....2-7
2.2.1 The Advantages of RISC....2-8

2.3 The SPARC Architecture 2-8

2.3.1 Register Windows....2-8

Section 3

Product Description 3-9

3.1 Concept....3-9
3.2 Integer Unit 3-9
3.3 Floating-point Unit....3-10
3.4 Co-processor Unit....3-10
3.5 Instruction Set ....3-10
3.6 On-chip Peripherals 3-10

3.6.1 Memory Mapping....3-10

3.6.2 System Registers 3-12

3.6.3 Waitstate and Timeout Generator 3-13

3.6.4 EDAC....3-14

3.6.5 Memory and I/O Parity....3-15

3.6.6 DMA....3-18

3.6.7 Traps 3-19

3.6.8 Timers....3-31

3.6.9 UARTs....3-36

3.6.10 General-purpose Interface....3-37

3.6.11 Execution Modes ....3-38

3.6.12 Error Handler....3-39

3.6.13 Parity Checking 3-40

3.6.14 System Clock....3-40

3.6.15 System Availability....3-40

3.6.16 Test Mode....3-40

3.7 Test and Diagnostic Hardware Functions ....3-41

3.8 Test Access Port....3-41

3.8.1 TAP Interface....3-41

3.8.2 Board Level Architecture 3-41

3.8.3 TAP Architecture ....3-42

3.9 TAP Controller 3-42

3.9.1 TAP Controller FSM 3-42

3.10 The Instruction Register....3-43

3.10.1 List of Instructions....3-43

3.10.2 Mandatory Instructions ....3-43

3.10.3 Defined Optional Instructions 3-44

3.10.4 Owner Instructions....3-44

3.11 Test Data Registers 3-45

3.11.1 Bypass Register 3-45

3.11.2 Device ID Register....3-45

3.11.3 Boundary Scan Register....3-45

3.11.4 Checkers Scan Register....3-45

3.11.5 IU Scan Register 3-45

3.11.6 FPU Scan Register....3-46

3.11.7 System Scan Register....3-46

3.11.8 OCD Scan Register....3-47

3.11.9 OCD Control and Status Register 3-47

3.12 On-chip Debugger Resources 3-48

3.12.1 Hardware Breakpoints....3-48

3.12.2 Processor Reset....3-49

3.12.3 Cycle Counter....3-49

3.12.4 Freeze/Run....3-50

3.12.5 Step-by-step....3-50

Section 4

Register Descriptions....4-51

4.1 IU Registers 4-51

4.2 Processor State Register....4-51

4.3 Window Invalid Mask 4-53

4.4 Trap Base Register....4-54

4.5 Y Register 4-54

4.6 Window Registers....4-55

4.7 FPU Registers....4-57

4.8 FPU Queue Registers....4-59

4.9 FPU f Registers....4-60

4.10 System Registers....4-60

4.10.1 System Management Registers 4-60

4.11 Configuration Registers 4-69

4.12 Access Protection Registers....4-77
4.13 Interrupt Registers....4-79
4.14 Timer Registers....4-89
4.15 Interface Registers....4-93

Section 5

Signals Description....5-98

5.1 IU and FPU Signals....5-98
5.2 Memory and System Interface Signals ....5-104
5.3 Error, DMA, Halt and Check Signals....5-105
5.4 Interrupt, Clock, UART, GPI, Timer, TAP and Test Signals....5-108
5.5 Power Signals ....5-110
5.6 Document History....5-110

■ Integer Unit Based on SPARC V7 High Performance RISC Architecture
■ Optimized and Integrated 32/64-bit Floating-point Unit
■ On-chip Peripherals – EDAC and Parity Generator and Checker
■ Memory Interface - Chip Select Generator - Waitstate Generation - Memory Protection
■ DMA Arbiter
■ Timers - General-purpose Timer (GPT) - Real-time Clock Timer (RTCT) - Watchdog Timer (WDT)
■ Interrupt Controller with 5 External Inputs
■ General-purpose Interface (GPI)
■ Dual UART
■ Speed Optimized Code RAM Interface 8- or 40-bit Boot-pROM (Flash) Interface
■ IEEE 1149.1 Test Access Port (TAP) for Debugging and Test Purposes
■ Fully Static Design
■ Performance: 20 MIPs/5 MFlops (Double Precision) at SYSCLK = 25 MHz – 5V
■ Core Consumption: 1.5W Typ at 25 MIPs/0.7W typ. at 10 MIPs - V _CC = 5V
■ Operating Range: 4.5V to 5.5V, -55°C to +125°C
■ Total Dose Radiation Capability (Parametric and Functional): 300 KRADs (Si)
■ SEU Event Rate Better than 1E-8 Error/Component/Day (Worst Case)
■ Latch-up Immunity Better than (LET) 100 MeV-cm ^2 /mg

■ Quality Grades: ESA SCC, QML Q or V
■ Package: 256 MQFPF, KGD

1.1 Description

The Rad Hard 32-bit SPARC Embedded Processor (TSC695F), ERC32 Single-chip, is a highly integrated, high-performance 32-bit RISC embedded processor implementing the SPARC architecture V7 specification. It has been developed with the support of the ESA (European Space Agency), and offers a full development environment for embedded space applications.

The processor is manufactured using the Atmel 0.5 m radiation tolerant ( ≥ 300 KRADs (Si)) CMOS enhanced process (RTP). It can operate at a low voltage for optimized power consumption. It has been especially designed for space, as it has on-chip concurrent transient and permanent error detection.

The TSC695F includes on-chip an Integer Unit (IU), a Floating-point Unit (FPU), a Memory Controller and a DMA Arbiter. For Real-time applications, the TSC695F offers a high security watchdog, two timer's, an interrupt controller, Parallel and Serial interfaces. Fault tolerance is supported using parity on internal/external buses and an EDAC on the external data bus. The design is highly testable with the support of an On-chip Debugger (OCD), an internal and boundary scan through JTAG interface.

1.2 Block Diagram

Figure 1-1. TSC695F Block Diagram
Microchip TSC695F - Block Diagram - 1

flowchart
graph TD
    A["TAP"] --> B["Clock and Reset Managt"]
    B --> C["32-bit Integer Unit"]
    C --> D["32/64-bit Floating-point Unit"]
    D --> E["DMA Arbiter"]
    D --> F["Access Controller"]
    D --> G["Wait State Controller"]
    D --> H["Address Interface"]
    D --> I["EDAC"]
    I --> J["Parity Gen./Check."]
    C --> K["Parity Gen./Chk."]
    K --> L["General-purpose Timer"]
    L --> M["Error Managt"]
    M --> N["General-purpose Interface"]
    N --> O["UART B UART A"]
    O --> P["Interrupt Controller"]
    P --> Q["Watch Dog"]
    Q --> R["Real-time Clock Timer"]
    R --> S["Data+Check bits"]
    R --> T["Parities"]
    style A fill:#f9f,stroke:#333
    style B fill:#f9f,stroke:#333
    style C fill:#ccf,stroke:#333
    style D fill:#ccf,stroke:#333
    style E fill:#cff,stroke:#333
    style F fill:#cff,stroke:#333
    style G fill:#cff,stroke:#333
    style H fill:#cff,stroke:#333
    style I fill:#cff,stroke:#333
    style J fill:#cff,stroke:#333
    style K fill:#ffc,stroke:#333
    style L fill:#ffc,stroke:#333
    style M fill:#ffc,stroke:#333
    style N fill:#ffc,stroke:#333
    style O fill:#ffc,stroke:#333
    style P fill:#ffc,stroke:#333
    style Q fill:#ffc,stroke:#333
    style R fill:#ffc,stroke:#333
    style S fill:#ffc,stroke:#333
    style T fill:#ffc,stroke:#333

InterruptsRxD, TxDGPI Bits

1.3 Pin Description

Table 1-1. Signal Descriptions

Signal Type AActive Description
RA[31:0] I/O 32-bit registered address bus Output buffer: 400 pF
RAPARI/OHighRegistered address bus parity
RASI[3:0]I/O4-bit registered address space identifier

1-2 TSC695F User Manual

Microchip TSC695F - Pin Description - 1

Table 1-1. Signal Descriptions (Continued)

SignalTypeActiveDescription
RSIZE[1:0] I/O 2-bit registered bus transaction size
RASPAR I/O High Registered ASI and SIZE parity
CPAR I/O High Control bus parity
D[31:0] I/O 32-bit data bus
CB[6:0] I/O 7-bit check-bit bus
DPAR I/O High Data bus parity
RLDSTO I/O High Registered atomic load-store
ALEOLowAddress latch enable
DXFERI/O HighData transfer
LOCKI/O HighBus lock
RDI/O HighRead access
WEI/O LowWrite enable
WRTI/O HighAdvanced write
MHOLDO LowMemory bus holdMHOLD+FHOLD+BHOLD+FCCV
MDSO LowMemory data strobe
MEXCO LowMemory exception
PROM8I LowSelect 8-bit wide PROM
BA[1:0]OLatched address used for 8-bit wide boot PROM
ROMCSOLowPROM chip select
ROMWRTI LowROM write enable
MEMCS[9:0]O LowMemory chip selectOutput buffer: 400 pF
MEMWRO LowMemory write strobeOutput buffer: 400 pF
OEO LowMemory output enableOutput buffer: 400 pF
BUFFENO LowData buffer enable
DDIRO HighData buffer direction
DDIRO LowData buffer direction
IOSEL[3:0]O LowI/O chip select
IOWRO LowI/O and exchange memory write strobe
EXMCSO LowExchange memory chip select
BUSRDYILowBus ready
BUSERRI LowBus error
DMAREQI LowDMA request
DMAGNTO LowDMA grant
DMAASI HighDMA address strobe
DRDYO LowData ready during DMA access
IUERRO LowIU error
CPUHALTO LowProcessor (IU and FPU) halt and freeze
SYSERRO LowSystem error
SYSHALTI LowSystem halt
SYSAVO HighSystem availability
NOPARI LowNo parity
INULLO HighInteger unit nullify cycle
INSTO HighInstruction fetchUsed to check the execute stage of IU instruction pipeline
FLUSHO HighFPU instruction flush
DIAO HighDelay instruction annulled
RTCOHighReal-time Clock Counter output
RxA/RxBIReceive data UART "A" and "B"Input trigger
TxA/TxBOTransmit data UART "A" and "B"
GPI[7:0] I/O GPIinput/outputInput trigger
GPIINT O HighGPI interrupt
EXTINT[4:0] IExternal interruptInput trigger
EXTINTACK OHigh External interruptacknowledge
IWDE IHigh Internal Watchdog enable
EWDINTIHighExternal Watchdog input interruptInput trigger
WDCLKIWatchdog clock
CLK2I Double frequencyfrequencyclock
SYSCLKOSystem clock
RESETO LowOutputreset
SYSRESETILowSystem input resetInput trigger
TMODE[1:0]I Factory test modeFunctional mode=00
DEBUGIHighSoftware debug mode
TCKITest (JTAG) clock
TRSTILowTest (JTAG) resetpull-up ≈ 37 kΩ
TMSITest (JTAG) mode selectpull-up ≈ 37 kΩ
TDIITest (JTAG) data inputpull-up ≈ 37 kΩ
TDOOTest (JTAG) data output
VCCI/VSSIMain internal power
VCCO/VSSOOutput driver power

Note: If not specified, the output buffer type is 150 pF, the input buffer type is TTL.

1.4 System

Architecture

The TSC695F is to be used as an embedded processor requiring only memory and application specific peripherals to be added to form a complete on-board computer. All other system support functions are provided by the core.

Figure 1-2. TSC695F 32-bit System Architecture
Microchip TSC695F - Architecture - 1

flowchart
graph TD
    A["Master"] --> B["Local Memory"]
    B --> C["Memory Interface"]
    C --> D["Memory Module"]
    D --> E["User Application"]
    subgraph DMA_Unit
        F["Ax[31:0"]] --> G["Amplifier"]
        G --> H["Amplifier"]
        H --> I["Amplifier"]
        I --> J["Amplifier"]
        J --> K["Amplifier"]
        K --> L["Amplifier"]
        L --> M["Amplifier"]
        M --> N["Amplifier"]
    end

    subgraph Memory_Interface
        O["DMAGNT"] --> P["Amplifier"]
        P --> Q["Amplifier"]
        Q --> R["Amplifier"]
        R --> S["Amplifier"]
        S --> T["Amplifier"]
        T --> U["Amplifier"]
        U --> V["Amplifier"]
        V --> W["Amplifier"]
    end

    subgraph RAM_Memory
        X["RAM Ctrl"] --> Y["(MEMCS[9:0"], MEMWR, OE)]
        Y --> Z["RAM Memory (0 WS)"]
    end

    subgraph Peripherals
        AA["FPU"] --> AB["Memory Interface"]
        AC["IU"] --> AD["Memory Interface"]
        AE["User Application"] --> AF["User Application"]

    subgraph Boot_PROM
        AG["Xtd PROM"] --> AH["Boot Prom"]
        AI["Xchg Mem"] --> AJ["Xtd Prom"]
        AK["Xtd RAM"] --> AL["Xtd RAM"]
        AM["I/O 0 to I/O 3"] --> AN["I/O 0 to I/O 3"]
        AO["Xtd I/O"] --> AP["Xtd I/O"]
        AQ["Xtd General"] --> AR["Xtd General"]
    end

    subgraph DMA_Unit
        AS["RA[31:0"]] --> AT["AMplifier"]
        AU["CB[6:0"] DPAR] --> AV["AMplifier"]
        AW["RAMCtrl"] --> AX["RAM Memory (0 WS)"]
    end

    subgraph Memory_Interface
        AY["SYSCLK"] --> AZ["ALE"]
        BA["DMA"] --> BB["DMA"]
        BC["D31:0"] --> BD["DMA"]
    end

    subgraph Peripherals
        BE["A[31:0"]] --> BF["AMplifier"]
        BG["D31:0"] --> BH["AMplifier"]
    end

    subgraph User_Application
        BI["User Application"] --> BJ["User Application"]
    end

    A --> M
    B --> M
    C --> M
    D --> M
    E --> M
    F --> M
    G --> M
    H --> M
    I --> M
    J --> M
    K --> M
    L --> M
    M --> N
    N --> AO
    AO --> AQ

TSC695F

Figure 1-3. TSC695F 8-bit System Architecture
Microchip TSC695F - Architecture - 2

flowchart
graph TD
    subgraph TSC695F
        A["FPU"] --> B["Memory Interface"]
        C["IU"] --> B
        B --> D["SYSCLK"]
        B --> E["ALE"]
        B --> F["RA[31:0"]]
        B --> G["D[31:0"]]
        H["Peripherals"] --> I["GPI[7:0"]]
        H --> J["EXTINT[4:0"]]
        H --> K["RTC"]
        H --> L["Rx, Tx"]
        H --> M["......"]
    end

    subgraph Memory
        N["Add, Data"] --> O["ROMCS"]
        P["MEMWR, OE"] --> Q["BUFFEN, DDIR"]
        R["BUSRDY (optional if no WS)"] --> S["Add. decod"]
        T["8-bit bi-dir (optional)"] --> U["RD[7:0"]]
    end

    subgraph Flash Possibility
        V["WR, OE"] --> W["8-bit"]
        X["CS"] --> Y["Boot"]
        Z["ROM"] --> AA["(Flash Possibility)"]
        AB["WR, OE"] --> AC["8-bit SRAM in Xtd PROM Area(1)"]
        AD["CS"] --> AC
    end

    subgraph User Application
        AE["User Application"] --> AF["RD[7:0"]]
    end

    B -->|A["31:0"]| G
    B -->|D["31:0"]| U
    B -->|RA["31:0"]| S
    B -->|RSR["RSR"] -->|U| AC
    B -->|RSR -->|AC
    B -->|RSR -->|AC
    B -->|RSR -->|AC
    B -->|RSR -->|AC
    B -->|RSR -->|AC
    B -->|RSR -->|AC
    B -->|RSR -->|AC
    B -->|RSR -->|AC
    B -->|RSR -->|AC
    B -->|RSR -->|AC
    B -->|RSR -->|RC
    B -->|RSR -->|RC
    B -->|RSR -->|RC
    B -->|RSR -->|RC
    B -->|RSR -->|RC
    B -->|RSR -->|RC
    B -->|RSR -->|RC
    B -->|RSR -->|RC
    B -->|RSR -->|RC
    B -->|RSR -->|RC
    B -->|RSR -->|PC
    B -->|RSR -->|PC
    B -->|RSR -->|PC
    B -->|RSR -->|PC
    B -->|RSR -->|PC
    B -->|RSR -->|PC
    B -->|RSR -->|PC
    B -->|RSR -->|PC
    B -->|RSR -->|PC
    B -->|RSR -->|PC

Note: 1. The SRAM area is "emulated" by the extended ROM area.
This area size can be up to 15M bytes (from 0x 0100 0000 upto 0x 01EF FFFF).
This area is BUSRDY controlled for wait states.
This area is not protected by parity, neither by EDAC.

The TSC695F is a 32-bit RISC processor implementing the SPARC architecture V7 specification.

2.1 The RISC Machine

A Reduced Instruction Set Computer is a microprocessor designed to perform a small number of types of computer instructions so that it can operate at a higher speed (perform more MIPS [Millions of Instructions Per Second]). The term itself (RISC) is credited to David Petersen, a teacher at the University of California in Berkeley.

2.2 The Characteristics of RISC

■ Simple instruction set – In a RISC machine, the instruction set contains simple, basic instructions, from which more complex instructions can be composed. The instruction set can be hardwired to speed instruction execution. No microcode is needed for single cycle execution.
■ Same length instructions – Each instruction is the same length, so that it may be fetched in a single operation.
- Reduced memory access – Only load and store instructions access memory. There are no computational instructions that access memory. Load/store instructions operate between memory and a register. This simplifies control hardware and minimizes the machine cycle time.
■ Small number of addressing modes – The instruction set uses only short displacement, long displacement, and indexed modes to access memory.
■ 1 machine-cycle instructions. – Most instructions complete in one machine cycle, which allows the processor to handle several instructions at the same time. This pipelining is a key technique used to speed up RISC machines.
- Pipelining – Pipelining is a design technique where the computer's hardware processes more than one instruction at a time, and doesn't wait for one instruction to complete before starting the next. The four stages are: fetch, decode, execute, and write. The stages are executed in parallel. As soon as one stage completes, it passes on the result to the next stage and then begins working on another instruction. Pipelining doesn't improve the latency of instructions (each instruction still requires the same amount of time to complete), but it does improve the overall throughput.

2.2.1 The Advantages of RISC■ Dependencies – One problem that RISC programmers face is that the processor can be slowed down by a poor choice of instructions. Since each instruction takes some amount of time to store its result, and several instructions are being handled at the same time, later instructions may have to wait for the results of earlier instructions to be stored.However, a simple rearrangement of the instructions in a program (called Instruction Scheduling) can remove these performance limitations from RISC programs.■ Speed – Since a simplified instruction set allows for a pipelined, the RISC processors often achieve 2 to 4 times the performance of CISC processors using comparable semiconductor technology and the same clock rates.■ Integration – Because the instruction set of a RISC machine is so simple, it uses up much less chip space. Extra functions, such as floating-point arithmetic unit, memory controller, standard peripherals can also be placed on the same chip.■ Software – Operating system and application programs who use the microprocessor's instructions will find it easier to develop code with a smaller instruction set.The simplicity of RISC allows more freedom to choose how to use the space on a microprocessor.■ Compilers – Higher-level language compilers produce more efficient code because they have always tended to use the smaller set of instructions to be found in a RISC computer.

2.3 The SPARC Architecture

The Scalable Processor Architecture is an open industry-standard architecture pioneered by SUN Microsystems in 1987.

The SPARC architecture's definition includes the IU (Integer Unit) which is the CPU, the FPU (Floating-point Unit) and the CP (Co-processor) which is optional. Other options are memory controller, memory management unit and cache.

2.3.1 Register Windows

An important concept of the SPARC architecture is borrowed from the Berkeley RISC chips. This is register windowing concept. When a program is running, it has access to 32 32-bit processor registers which include 8 global registers plus 24 registers that belong to the current register window.

■ The first 8 registers in the window are called the in registers' (i0-i7). When a function is called, these registers may contain arguments that can be used.
The next 8 are the 'local registers' (10-17) which are scratch registers that can be used for anything while the function executes.
The last 8 registers are the 'out registers' (o0-o7) which the function uses to pass arguments to functions that it calls.

When one function calls another, the calling function can choose to execute a SAVE instruction. This instruction decrements an internal counter, the current window pointer (cwp), shifting the register window downward. The caller's out registers then become the calling function's in registers, and the calling function gets a new set of local and out registers for its own use. Only the pointer changes because the registers and return address do not need to be stored on a stack.

The RETURN instruction acts in the opposite way.

Product Description

3.1ConceptThe objective of the TSC695F is to provide a high-performance 32-bit embedded processor, with which computers for on-board embedded real-time applications can be built. The component will be characterized by low circuit complexity and power consumption. Extensive concurrent error detection and support for fault tolerance and reconsideration will also be emphasized. In addition to the main objective, the TSC695F should be used for performance demanding research applications in deep space probes. The radiation tolerance and error masking are therefore important. For the real-time applications the system might be fail-operational rather than fail-safe. By including support for reconfiguration of the error-handling, the different demands from the applications can be optimized for the best purpose in each case.The TSC695F will be used as a building block only requiring memory and application specific peripherals to be added to form a complete on-board computer. All other system support functions are provided by the TSC695F.
3.2Integer UnitThe IU is designed for highly dependable space and military applications, and includes support for error detection. The RISC architecture makes possible the creation of a processor that can execute instructions at a rate approaching one instruction per processor clock.To achieve that rate of execution, the IU employs a four-stage instruction pipeline that permits parallel execution of multiple instructions.Fetch – The processor outputs the instruction address to fetch the instruction.Decode – The instruction is placed in the instruction register and is decoded. The processor reads the operands from the register file and computes the next instruction address.Execute – The processor executes the instruction and saves the results in temporary registers. Pending traps are prioritized and internal traps are taken during this stage.Write – If no trap is taken, the processor writes the result to the destination register.All four stages operate in parallel, working on up to four different instructions at a time. A basic 'single-cycle' instruction enters the pipeline and completes in four cycles.By the time it reaches the write stage, three more instructions have entered and are moving through the pipeline behind it. So, after the first four cycles, a single-cycle instruction exits the pipeline and a single-cycle instruction enters the pipeline on every

TSC695F User Manual 3-9

cycle. Of course, a 'single-cycle' instruction actually takes four cycles to complete, but they are called single cycle because with this type of instruction the processor can complete one instruction per cycle after the initial four-cycle delay.

3.3 Floating-point UnitThe FPU is designed to provide execution of single and double-precision floating-point instructions concurrently with execution of integer instructions by the IU. The FPU is compliant to the ANSI/IEEE-754 (1985) floating-point standard.The FPU is designed for highly dependable space and military applications, and includes support for concurrent error detection and testability.The FPU uses a four stage instruction pipeline consisting of fetch, decode, execute and write stages (F, D, E and W). The fetch unit captures instructions and their addresses from the data and address buses. The decode unit contains logic to decode the floating-point instruction opcodes. The execution unit handles all instruction execution. The execution unit includes a floating-point queue (FP queue), which contains stored floating-point operate (FPop) instructions under execution and their addresses. The execution unit controls the load unit, the store unit, and the datapath unit. The FPU depends upon the IU to access all addresses and control signals for memory access. Floating-point loads and stores are executed in conjunction with the IU, which provides addresses and control signals while the FPU supplies or stores the data. Instruction fetch for integer and floating-point instructions is provided by the IU.The FPU provides three types of registers: f registers, FSR, and the FP queue. The FSR is a 32-bit status and control register. It keeps track of rounding modes, floating-point trap types, queue status, condition codes, and various IEEE exception information. The floating-point queue contains the floating-point instruction currently under execution, along with its corresponding address.
3.4 Co-processor UnitNo co-processor unit is available on TSC695F. Attempting to execute co-processor instructions will cause the TSC695F to execute a 'cp disable' trap ( tt = 0x24 ).
3.5 Instruction SetTSC695F instructions fall into six functional categories: load/store, arithmetic/logical/shift, control transfer, read/write control registers, floating-point-operate and miscellaneous.

Note: The execution of IFLUSH will cause an 'illegal instruction' trap (tt = 0x02).

3.6 On-chip Peripherals

3.6.1 Memory MappingThe TSC695F is designed to allow an easy interface to internal/external memory resources.

3-10 TSC695F User Manual

Microchip TSC695F - On-chip Peripherals - 1

Table 3-1. Memory Mapping

Memory ContentsStart AddressSize (bytes)Data Size and Parity Options Access and Waitstate Control
Boot PROM0x 0000 0000128K → 16M8-bit mode- No parity - Only byte writeROMCSMEMWR OEOEBUFFEN and DDIRinternal WS generation 8 = 0
40-bit mode- Parity+EDAC mandatory - Only word write 8 = 1
Extended PROM0x 0100 0000Max: 15M8-bit mode- No parity - Only byte write(no CS)BUSRDY -8 = 0 - timeout
40-bit mode- Parity+EDAC mandatory - Only word write -8 = 1 - BUSERR - timeout
Exchange Memory0x 01F0 00004K → 512K- Parity + EDAC options - Only word writeEXMCSIOWR MEMWROEBUFFEN and DDIRi. WS g. and BUSRDY- BUSERR - timeout
System Registers0x 01F8 0000512K (124 used)- Internal parity - Only word write access
RAM (8 blocks)0x 0200 00008*32K → 8*4M- Parity + EDAC options - All data sizes allowedRAMCS [9:0]MEMWR OEOE/internal WS g./
Extended RAM0x 0400 0000Max: 192M(no CS)BUFFEN and DDIRBUSRDYBUSERR
I/O Area 00x 1000 0000Max: 16M- Parity option - No EDAC - All data sizes allowedIOSEL [3:0]IOWR OEBUFFEN and DDIRinternal WS generation and BUSRDY- BUSERR - timeout
I/O Area 10x 1100 0000Max: 16M
I/O Area 20x 1200 0000Max: 16M
I/O Area 30x 1300 0000Max: 16M
Extended I/O Area0x 1400 0000Max: 1728MSame setting as for I/O Area 3(no CS)BUSRDY
Extended General0x 8000 0000Max: 2G- No parity, no EDAC - All data sizes allowed(no CS)IOWR OEBUFFEN and DDIRBUSRDY /

3.6.2 System Registers

The system registers are only writable by IU in the supervisor mode or by DMA during halt mode. All the readable registers, except UARTAR and UARTBR, can be accessed in every access mode. UARTAR and UARTBR are only readable by IU in supervisor mode or by DMA during halt mode. Byte or half-word store access is not allowed. A wrong access type will generate a Memory Exception (MEXC). Only byte, half-word load access and word access are granted.

Table 3-2. System Registers Address Map

System Register Name Address Read/Write Access
System Control Register SYSCTR 0x 01F8 0000 All R Supervisor W
Software Reset SWRST 0x 01F8 0004 Supervisor W
Power-down PDOWN 0x 01F8 0008 Supervisor W
System Fault Status RegisterSYSFSR0x 01F8 00A0All RSupervisor W
Failing Address RegisterFAILAR 0x01F8 00A4All R
Error and Reset Status RegisterERRRSR0x 01F8 00B0All RSupervisor W
Test Control RegisterTESCTR0x 01F8 00D0All RSupervisor W
Memory Configuration RegisterMCNFR0x 01F8 0010All RSupervisor W
I/O Configuration RegisterIOCNFR0x 01F8 0014All RSupervisor W
Waitstate Configuration RegisterWSCNFR0x 01F8 0018All RSupervisor W
Access Protection Segment 1 Base RegisterAPS1BR0x 01F8 0020All RSupervisor W
Access Protection Segment 1 End RegisterAPS1ER0x 01F8 0024All RSupervisor W
Access Protection Segment 2 Base RegisterAPS2BR0x 01F8 0028All RSupervisor W
Access Protection Segment 2 End RegisterAPS2ER0x 01F8 002CAll RSupervisor W
Interrupt Shape RegisterINTSHR0x 01F8 0044All RSupervisor W
Interrupt Pending RegisterINTPDR0x 01F8 0048All R
Interrupt Mask RegisterINTMKR0x 01F8 004CAll RSupervisor W
Interrupt Clear RegisterINTCLR 0x01F8 0050 Supervisor W
Interrupt Force RegisterINTFCR0x 01F8 0054 All R Supervisor W
Watchdog Timer RegisterWDOGTR0x 01F8 0060All RSupervisor W
Watchdog Timer Trap Door SetWDOGST0x 01F8 0064 Supervisor W
Real-time Clock TimerRegisterRTCCR0x 01F8 0080All RSupervisor W
Real-time Clock TimerRegisterRTCSR0x 01F8 0084All RSupervisor W
General-purpose TimerRegisterGPTCR0x 01F8 0088All RSupervisor W
General-purpose TimerRegisterGPTSR0x 01F8 008CAll RSupervisor W
Timers Control RegisterTIMCTR0x 01F8 0098 All R Supervisor W
General-purpose Interface Configuration RegisterGPICNFR0x 01F8 00A8All RSupervisor W
General-purpose Interface Data RegisterGPIDATR0x 01F8 00ACAll RSupervisor W
UART 'A' Rx and Tx RegisterUARTAR0x 01F8 00E0Supervisor R/W

3-12 TSC695F User Manual

Microchip TSC695F - System Registers - 1

Table 3-2. System Registers Address Map (Continued)

System Register Name Address Read/Write Access
UART 'B' Rx and Tx Register UARTBR 0x 01F8 00E4 Supervisor R/W
UART Status Register UARTSR 0x 01F8 00E8 All R Supervisor W

Note: All reserved bits have to be written with zeros in order to avoid parity error resulting in an internal error.

3.6.3 Waitstate and Timeout Generator

It is possible to control the wait state generation by programming a Waitstate Configuration Register (WSCNFR). The maximum programmable number of wait-states is applied as default at reset.

It is only possible to program the number of wait states for the following combinations:

  • RAM read and RAM write
  • PROM read and PROM write (i.e., EEPROM or FLASH write)
    – Exchange Memory read/write
    – Four individual I/O peripherals read/write

On RAM accesses, the processor will insert the programmed number of waitstates after the first cycle.

On extended RAM accesses, one cycle is inserted at the beginning for permit an external address decoding. This area is BUSRDY controlled and no waitstate is available.

On PROM accesses, one cycle is inserted at the beginning (ROMCS is generated). Then, the processor will apply the programmed number of waitstates after the second cycle.

On extended PROM accesses, one cycle is inserted at the beginning for permit an external address decoding. This area is BUSRDY controlled and no waitstate is available.

On exchange memory accesses, the processor will sense the bus ready signal (BUS-RDY) after the first two cycles of the access. If the bus ready signal is asserted at this time the TSC695F will continue with the programmed number of waitstates. However, if the bus ready signal is deasserted, the start of the access is put on hold. Once the BUS-RDY signal is asserted again, the access will start with the programmed number of waitstates and finish with two cycles.

On I/O area accesses, the processor will provide the programmed number of waitstates after the first two cycles of the access. Then, the processor will sense the bus ready signal (BUSRDY). If the bus ready signal is deasserted, the access is put on hold. Once the BUSRDY signal is asserted again, the TSC695F will continue with two cycles.

A bus timeout function of 256 system clock cycles is provided for the bus ready controlled memory areas, i.e the Extended PROM, Exchange Memory, Extended RAM, Extended I/O and the Extended General areas. The bto bit of System Control Register is used to select this function. The default after system reset is that the bus timeout function is enabled.

The bus timeout counter will start when the access is initiated. If the BUSRDY signal is not asserted before a valid number of system clock cycles, a memory exception will occur.

3.6.4 EDAC

The TSC695F includes a 32-bit EDAC (Error Detection And Correction). Seven bits (CB[6:0]) are used as check bits over the data bus. The Data Bus Parity signal (DPAR) is used to check and generate the odd parity over the 32-bit data bus. This means that altogether 40 bits are used when the EDAC is enabled.

The TSC695F EDAC uses a seven bit Hamming code which detects any double bit error on the 40-bit bus as a non-correctable error. In addition, the EDAC detects all bits stuck-at-one and stuck-at-zero failure for any nibble in the data word as a non-correctable error. Stuck-at-one and stuck-at-zero for all 32 bits of the data word is also detected as a non-correctable error.

The EDAC corrects any single bit data error on the 40-bit bus. However, in order to correct any error in memory (e.g., Single Event Upset induced) the data has to be read and re-written by software as the TSC695F does not automatically write back the corrected data.

Figure 3-1 EDAC System Overview
Microchip TSC695F - EDAC - 1

flowchart
graph TD
    A["Data in"] --> B["trap"]
    B --> C["cap"]
    C --> D["Data - In Latch"]
    D --> E["EDAC"]
    E --> F["Hold"]
    F --> G["Interrupt Request Level"]
    G --> H["Interrupt Controller"]
    H --> I["Correctable error"]
    I --> J["UNcorrectable error"]
    J --> K["Check Bits in"]
    K --> L["MUX"]
    L --> M["Check Bits out"]
    M --> N["DB"]
    N --> O["RA[31:0"]]
    N --> P["D[31:0"]]
    N --> Q["DPAR"]
    N --> R["CB[6:0"]]
    N --> S["NOPAR"]
    T["Address"] --> U["Add Latch"]
    U --> V["Registered Address"]
    V --> W["QA[31:0"]]
    V --> X["D[31:0"]]
    V --> Y["DPAR"]
    V --> Z["NOPAR"]
    AA["IEU and FPU"] --> AB["Data - In Latch"]
    AB --> AC["Data"]
    AC --> AD["EDAC"]
    AD --> AE["Hold"]
    AE --> AF["Interrupt Controller"]
    AF --> AG["Correctable error"]
    AG --> AH["Check Bits in"]
    AH --> AI["MUX"]
    AI --> AJ["Check Bits out"]
    AJ --> AK["DB"]
    AK --> AL["NOPAR"]
    AL --> AM["NOPAR"]

3.6.5 Memory and I/O Parity

The TSC695F handles parity towards memory and I/O in a special way. The processor can be programmed to use no parity, only parity or parity and EDAC protection towards memory and to use parity or no towards I/O.

The signal used for the parity bit is DPAR. This pin is used to check and generate the odd parity over the 32-bit data bus according to the following table.

When a correctable error occurs in the RAM or exchange memory, parity is generated even if parity is disabled.

Table 3-3. DPAR and NOPAR Handling (See Figure 3-1)

Accessed Memory AreaMemory Parity EnabledNOPARRead or Fetch Access Write Access
PROM 8-bit Ext. PROM^(1) No1TSC695F ignores DPAR TSC695F generates DPAR
Internal- EDAC generates data parity- IU (FPU) checks data parityInternal- IU (FPU) generates data parity- EDAC checks data parity
0TSC695F ignores DPAR TSC695F generates DPAR
Internal- EDAC ignores data parity- IU (FPU) ignores data parity but generates its own parity for its internal usageInternal- IU (FPU) generates data parity- EDAC ignores data parity
PROM 40-bit Ext. PROM^(1) Yes1TSC695F samples DPAR TSC695F generates DPAR
Internal- EDAC checks data parity- IU (FPU) checks data parityInternal- IU (FPU) generates data parity- EDAC checks data parity
0TSC695F samples DPAR TSC695F generates DPAR
Internal- EDAC checks parity- IU (FPU) ignores data parity but generates its own parity for its internal usageInternal- IU (FPU) generates data parity- EDAC ignores data parity
RAMExt. RAM^(2) Exchange MemoryI/O [3:0]Ext. I/O^(3) no‘rpa’ = 0‘epa’ = 0‘pa_x’ = 01TSC695F ignores DPAR TSC695F generates DPAR
Internal- EDAC generates data parity- IU (FPU) checks data parityInternal- IU (FPU) generates data parity- EDAC checks data parity
yes‘rpa’ = 1‘epa’ = 1‘pa_x’ = 11TSC695F samples DPAR TSC695F generates DPAR
Internal- EDAC checks data parity- IU (FPU) checks data parityInternal- IU (FPU) generates data parity- EDAC checks data parity
no‘rpa’ = 0‘epa’ = 0‘pa_x’ = 00TSC695F ignores DPAR TSC695F generates DPAR
Internal- EDAC ignores data parity- IU (FPU) ignores data parity but generates its own parity for its internal usageInternal- IU (FPU) generates data parity- EDAC ignores data parity
yes‘rpa’ = 1‘epa’ = 1‘pa_x’ = 10TSC695F samples DPAR TSC695F generates DPAR
Internal- EDAC checks data parity- IU (FPU) ignores data parity but generates its own parity for its internal usageInternal- IU (FPU) generates data parity- EDAC ignores data parity
System RegistersYes1TSC695F ignores DPAR TSC695F doesn't generate DPAR
Internal- EDAC checks data parity- IU (FPU) checks data parityInternal- IU (FPU) generates data parity- EDAC checks data parity
0TSC695F ignores DPAR TSC695F doesn't generate DPAR
Internal- EDAC checks data parity- IU (FPU) ignores data parity but generates its own parity for its internal usageInternal- IU (FPU) generates data parity- EDAC ignores data parity
Extended GeneralNo1TSC695F ignores DPAR TSC695F generates DPAR
Internal- EDAC generates data parity- IU (FPU) checks data parityInternal- IU (FPU) generates data parity- EDAC checks data parity
0TSC695F ignores DPAR TSC695F generates DPAR
Internal- EDAC ignores data parity- IU (FPU) ignores data parity but generates its own parity for its internal usageInternal- IU (FPU) generates data parity- EDAC ignores data parity

Notes: 1. Extended PROM area has the same configuration (memory parity enabled/disabled) than PROM area.
2. Extended RAM area has the same configuration (memory parity enabled/disabled) than RAM area.
3. Extended I/O area has the same configuration (memory parity enabled/disabled) than I/O[3] area.

3.6.5.1 Memory Redundancy

■ Programming the Memory Configuration Register – The TSC695F provides chip selects for two redundant memory banks for replacement of faulty banks. A memory bank is a block composed of 32-bit data, parity and a 7-bit check-code and controlled with one chip select signal. The size of the redundant memory banks are dependent of the memory size register.

3.6.5.2 Memory Access Protection

■ Unimplemented Areas – Accesses to all unimplemented memory areas are handled by the TSC695F and detected as illegal. The memory and I/O configuration registers define the size of memory and I/O areas. Then, if the TSC695F or the DMA Unit access the unused area of the memory space is decoded as illegal, a memory exception is asserted.

■ RAM Write Access Protection
Figure 3-2 RAM Write Access Protection
Microchip TSC695F - Memory Access Protection - 1

flowchart
graph TD
    A["RAM and Extended RAM areas"] --> B["Segment 1"]
    A --> C["Segment 2"]
    B --> D["Write → MEXC"]
    C --> E["Write → MEXC"]
    D --> F["Write → MEXC"]
    E --> G["Write → MEXC"]
    style A fill:#f9f,stroke:#333
    style B fill:#ccf,stroke:#333
    style C fill:#ccf,stroke:#333
    style D fill:#cff,stroke:#333
    style E fill:#cff,stroke:#333
    style F fill:#ffc,stroke:#333
    style G fill:#ffc,stroke:#333

Microchip TSC695F - Memory Access Protection - 2

flowchart
graph TD
    A["RAM and Extended RAM areas"] --> B["Segment 1"]
    A --> C["Segment 2"]
    B --> D["Write → MEXC"]
    C --> E["Write → MEXC"]
    style A fill:#f9f,stroke:#333
    style B fill:#ccf,stroke:#333
    style C fill:#ccf,stroke:#333
    style D fill:#dfd,stroke:#333
    style E fill:#dfd,stroke:#333

Two segments are implemented. Each segment is defined by a Segment Base (defined in APS1BR or APS2BR registers) and a Segment End (defined in APS1ER or APS2ER registers).

The segment access protection can be used as a block protect function by setting the bp bit in the System Control Register. The bp bit inverts the address criterion for the protection function so that any access within the segment is detected.

The TSC695F can also be programmed to detect and mask write accesses (in supervisor or/and user mode) in any part of the RAM. The protection scheme is enabled only for data area, not for the instruction area. The programmable write access protection is segment based.

■ Boot PROM Write Protection – The TSC695F supports PROM write only when it is qualified by the external enable pin ROMWRT (ROMWRT*) and the enable bit in the Memory Configuration Register. The TSC695F only supports byte write operations for an 8-bit wide PROM and only word write operations for a 40-bit wide PROM.

If a write access to PROM is attempted when any of the above conditions are not fulfilled, the System Fault Status Register and the Failing Address Register is updated as for unimplemented area access.

3.6.6 DMA

3.6.6.1 DMA Interface

■ The TSC695F supports Direct Memory Access (DMA) – The DMA unit requests access to the processor bus by asserting the DMA request signal (DMAREQ). When the DMA unit receives the DMAGNT signal in response, the processor bus is granted. In case the processor is in the power-down mode the processor is permanent tri-stated, and a DMAREQ will directly give a DMAGNT.

A memory cycle started by the processor is not interrupted by a DMA access before it is finished.

Because the TSC695F provides registered address buses, the DMA unit must generate such buses characteristics.

The TSC695F includes a DMA session timeout function preventing the DMA unit from locking out the processor by asserting DMAREQ for more than 1024 system clock cycles after the assertion of DMAGNT. Then, a memory exception is asserted and the DMAGNT is removed.

3.6.6.2 Bus Arbiter

The TSC695F always has the lowest priority on the system bus and is denied access to memory in case of a request from a DMA unit, unless the IU is performing a locked access or after a DMA exception cycle to allow interrupt handling.

Thus the DMA is granted access to the system bus provided this has been enabled by the processor.

3.6.7 Traps

The TSC695F supports two types of traps: synchronous and asynchronous (also called interrupts). Synchronous traps are caused by hardware responding to a particular instruction or by the Trap on integer condition code (Ticc) instructions; they occur during the instruction that caused them. Asynchronous traps occur when an external event interrupts the processor. They are not related to any particular instruction and occur between the execution of instructions.

A trap is a vectored transfer of control to the supervisor through a special trap table that contains the first four instructions of each trap handler. The base address of the table is established by supervisor and the displacement, within the table, is determined by the trap type.

Table 3-4. TSC695F – Errors, Traps and Priority Assignments

Trap and/or errorSyncAsyncPriorityTrap Type (tt)Output Signal ObservationComments
Reset Sync. 1(highest priority)/ RESETSources: - SYSRESET pin- OCD reset- Software reset- Watchdog reset- (IU or System) error reset
IUP Hardware errorNon-restartable, imprecise errorSync. 22.51 0x64 SYSERR(if unmasked)Severe error requiring a re-boot (ePC, wPC, PSR, ...)TSC695F enters (if not masked) in halt or reset mode.
Non-restartable, precise errorSync.2.20x62Error not removable, PC and nPC OK (dPC, WIM, TBR, ...)TSC695F enters (if not masked) in halt or reset mode.
Register file errorSync.2.30x65Special case (register file) of non-restartable, precise error.TSC695F enters (if not masked) in halt or reset mode.
Restartable, late errorSync.2.40x63Retrying instruction but PC and nPC have to be re-adjusted (data load, ...)TSC695F enters (if not masked) in halt or reset mode.
Restartable, precise errorSync. 2.50x61TSC695F enters (if not masked) in halt or reset mode.
Error modeSync.IUERRSYSERR(if unmasked)Trap occurs with et %psr bit = 0.Trap 'Masked hardware errors' if enabled.TSC695F enters (if not masked) in halt or reset mode.

Table 3-4. TSC695F – Errors, Traps and Priority Assignments (Continued)

Trap and/or errorSyncAsyncPriorityTrap Type (tt)Output Signal ObservationComments
Instruction access Sync. 3 0x01 MEXC Error on instruction fetch:- Parity error on control bus (refer to CPAR signal description)- Parity error on data bus (refer to DPAR signal description)- Parity error on address bus (refer to RAPAR signal description)- Access to protected or unimplemented area- Uncorrectable error in memory (refer to “EDAC” section)- Bus time out (refer to “Waitstate and Timeout Generator” section)- Bus error (refer to BUSERR* signal description)
Illegal Instruction Sync. 4 0x02
Privileged instruction Sync. 5 0x03
FPU disabled Sync. 60x04 FP U disabled by ef %psr bit = 0
Co-processor disabledSync. 6 0x24 Co-processor not implemented in TSC695F
WindowOverflow Sync. 7 0x05 During SAVE instruction or trap taken
Underflow Sync. 0x06 During RESTORE instruction or RETT instruction
Memory add. not alignedSync. 8 0x07
FPU exceptionNon-restartable errorSync.99.10x08 Severe error, cannot restart the instruction.
Data bus errorSync.9.2
Restartable errorSync.9.3
Sequence errorSync.9.4
Unimplemented FPopSync.9.5
IEEE exceptions:Sync.9.6
Unfinished FPopSync.Never asserted. No trap nor error
Data accessSync. 10 0x09 MEXC Error on data load:- Parity error on control bus (refer to CPAR signal description)- Parity error on data bus (refer to DPAR signal description)- Parity error on address bus (refer to RAPAR signal description)- Access to protected or unimplemented area- Uncorrectable error in memory (refer to “EDAC” section)- Bus time out (refer to “Waitstate and Timeout Generator” section)- Bus error (refer to BUSERR* signal description)- System register access violation

Table 3-4. TSC695F – Errors, Traps and Priority Assignments (Continued)

Trap and/or errorSyncAsyncPriorityTrap Type (tt)Output Signal ObservationComments
Tag overflow Sync. 110x0A TAADDccTVand TSUBccTV instructions
Trap instructions Sync.12 0x80to 0xFFTrap on integer condition codes (Ticc)
System hardware errorSync. SYSERR(if unmasked)Parity error on system registers Trap 'Masked hardware errors' if enabled.
Watchdog timeout Async. 13 0x1F INT level=15No-maskable- Internal or external (EWDINT pin)
External INT 4Async.140x1EEXTINTAKINT level=14EXTINTAK on only one of EXTINT[4:0]
Real time clock timerAsync.150x1DRTCINT level=13
General-purpose timerAsync.16 0x1CINT level=12
External INT 3Async.170x1BEXTINTAKINT level=11EXTINTAK on only one of EXTINT[4:0]
External INT 2Async.180x1AEXTINTAKINT level=10EXTINTAK on only one of EXTINT[4:0]
DMA timeoutAsync.190x19INT level=9DMA session exceeds permitted time
DMA access errorAsync.200x18INT level=8DMA performs an access error, access violation or illegal access
UART ErrorAsync.21 0x17INT level=7
Correctable memory errorAsync.220x16INT level=6EDAC detects and corrects an error. Data read OK but source (memory contents) not updated.
UARTB- Data ready - Trans. readyAsync.230x15INT level=5Generated by the UARTs each time a data word has been correctly received or/and sent
UARTA- Data ready - Trans. readyAsync.24 0x14INT level=4
External INT 1Async.250x13EXTINTAKINT level=3EXTINTAK on only one of EXTINT[4:0]
External INT 0Async.260x12EXTINTAKINT level=2EXTINTAK on only one of EXTINT[4:0]
Masked hardware errorsAsync.27 (lowest priority)0x11 IUERR (if IU error mode)INT level=1When a hardware error is set in the Error and Reset Status Register and the error is masked.It is the OR of:- IU hardware error masked- IU error mode masked- System hardware error masked

When synchronous traps and asynchronous traps occur in the same cycle, the synchronous trap with the highest priority is taken and other synchronous traps (with lower priority) are ignored. At the same time, the asynchronous traps are reported as pending in the 'interrupt pending' register. Once the synchronous trap with the highest priority is

handled, the unmasked asynchronous traps are handled (from the highest priority to the lowest priority).

If a synchronous trap event occurs during memory access, the System Fault Status register is updated in accordance with the synchronous condition table (see table 3-5). The System Fault Status register (SYSFSR) also indicates the type of error and whether this type of error is valid. At the same time, the failing address is stored in the Failing Address Register (FAILAR).

Table 3-5. SYSFSR & FAILAR Update -synchronous condition table

Synchronous Fault TypeInstruction access Data access
SYSFSR FAILAR SYSFSR FAILAR
partyer
partyer
partyer
accesto
accesto
systeme
systeme
uncorec
bus timeoutNUUU
buseror

Note: U means that the register is updated N means that the register is not updated

If an asynchronous trap event occurs, the System Fault Status register is updated and reflects the type of error in accordance with the asynchronous condition table (refer to table 3-6). The System Fault Status register (SYSFSR) also indicates whether the type of error is valid. At the same time, the failing address is stored in the Failing Address Register (FAILAR) in accordance with the table 3-6.

An asynchronous fault can only update SYSFSR (and FAILAR) if none of the synchronous and asynchronous fault valid bit is set in SYSFSR. In case one of the fault valid bits is set, a trap is generated but information in the SYSFSR and FAILAR are irrelevant.

Table 3-6. SYSFSR & FAILAR Update -asynchronous condition table

Asynchronous Fault Type SYSFSR FAILAR
Watchdog timeout U N
External INT 4 N N
Real time clock timer N N
General-purpose timer N N
External INT 3 N N
External INT 2 N N
DMA timeout U N
DMA access error U U
UART Error U N
Correctable memory errorU U
UARTBN N
UARTAN N
External INT 1 N N
External INT 0 N N
Masked hardware errorsN N

Note: U means that the register is updated N means that the register is not updated

The fault valid bits are reset by writing any value to the SYSFSR register. The register is set to the value 0x00000078 (reset value).

3.6.7.1 Synchronous Traps

- Reset – The reset trap is a special case of the external asynchronous trap type. It is asynchronous because it is triggered by asserting the RESET input signal. But from that point on, its behavior is entirely different from that of an asynchronous interrupt.

As soon as the IU recognizes the RESET signal, it enters reset mode (Reset Mode) and stays there until the RESET line is deasserted. The processor then enters execute mode and then the execute trap procedure. Here, it deviates from the normal action of a trap by modifying the enable traps bit (et = 0), and the supervisor bit (s = 1). It then sets the PC to 0 (rather than changing the contents of the TBR), the nPC to 4, and transfers control to location 0.

All other PSR fields, and all other registers retain their values from the last execute mode (upon power-up reset the state of all registers other than the PSR are undefined).

If the processor got to reset mode from error mode, then the normal actions of a trap have already been performed, including setting the tt field to reflect the cause of the error mode. Because this field is not changed by the reset trap, a post-mortem can be conducted on what caused the error mode. The processor enters error mode

whenever a synchronous trap occurs while traps are disabled.

- Hardware error – When a hardware error is detected, the trap handling routine saves the error information sampled in the Error and Reset Status Register.

The trap routine then resumes the instruction by returning from the trap routine. If the cause of the error was a transient fault, it may be removed by just resuming the instruction. If the error was caused by a fault that is not removable by resuming the instruction, another hardware error trap is generated and the trap handling routine propagates the error to a higher level of the application.

If the fault is in a critical register or latch which the trap handling routine uses, another hardware error trap is generated. A synchronous trap during the time when traps are disabled is a critical error and the TSC695F enters the error mode and halts. This means that the error detection mechanism has to detect the error when the faulty instruction is in the execute stage in order to handle the trap normally, i.e., correct PC for the faulty instruction.

■ Instruction access – An instruction access exception trap is generated if a memory exception occurs (MEXC signal is asserted) during an instruction fetch.
■ Illegal instruction

An illegal instruction trap occurs:

  • When the UNIMP instruction is encountered,
  • When an unimplemented instruction is encountered (excluding FPops and CPops),
    – In any of the situations below where the continued execution of an instruction would result in an illegal processor state:

  • Writing a value to the %psr's cwp field that is greater than the number of implemented windows (with WRPSR assembly instruction)

  • Executing an Alternate Space instruction with its i bit set to 1
  • Executing a RETT instruction with traps enabled (et = 1)
  • Executing an IFLUSH instruction

Unimplemented floating-point instructions do not generate an illegal instruction trap. They generate FPU exception. Floating-point instructions are coded with: op = 10 and op3 = 11010x.

  • Privileged instruction – This trap occurs when a privileged instruction is encountered while the PSR's supervisor bit is reset ( s = 0 ).
    ■ FPU disabled – A FPU disabled trap is generated when an FPop, FBfcc, or floating-point load/store instruction is encountered while the PSR's ef bit = 0.
    ■ Coprocessor disabled – A coprocessor disabled trap is generated when a CPop, CBccc, or coprocessor load/store instruction is encountered.
    ■ Window overflow – This trap occurs when the continued execution of a SAVE instruction would cause the cwp to point to a window marked invalid in the WIM register.
    ■ Window underflow – This trap occurs when the continued execution of a RESTORE instruction would cause the cwp to point to a window marked invalid in the WIM register. The window underflow trap type can also be set in the %psr during a RETT instruction, but the trap taken is a reset.

■ Memory address not aligned – Memory address not aligned trap occurs when a load or store instruction generates a memory address that is not properly aligned for the data type or if a JMP L instruction generates a PC value that is not word aligned (low-order two bits nonzero).

■ FPU exception

- Non-restartable error (%fsr's f t t field = 7)

This type of error concerns parity errors that were detected after the state of the FPU was changed and could not be removed by restarting the instruction (%fsr, Register File,...).

An hardware error will be asserted and stay asserted until the next FPop encountered in the instruction stream (after a STDFQ instruction) modifies the ftt field of %fsr.

- Data bus error (%fsr's f t t field = 5)

This type of error concerns parity errors on the internal data bus detected by the FPU.

- Restartable error (%fsr's f t t field = 6)

This type of error concerns parity errors in the FPU that were detected before changing the FPU state and could be removed by restarting the instruction (IU to FPU internal control bus, ...).

- Sequence error (%fsr's f t t field = 4)

This exception is asserted by the FPU when a floating-point instruction (other than FP store) is attempted after the FPU has entered either pending exception or exception mode. The FPU suspends all instruction execution with the exception of FP stores until the FP exception has been acknowledged and the FP queue has been cleared.

- Unimplemented FPop (%fsr's f t t field = 3)

This exception is asserted by the FPU upon encountering a defined SPARC FPop instruction that is not supported by the TSC695F. This includes all operations using extended-precision format operands. The trap handler is expected to emulate the unimplemented instruction.

- IEEE exceptions (%fsr's f t t field = 1)

This class of exceptions is defined as part of the IEEE-754 Standard. The five exceptions defined as IEEE Exceptions are reported in the cexc field and accumulated in the aexc field of the %fsr. The only exceptions that can coincide are inexact with overflow and inexact with underflow.

- Invalid Operation (\%fsr's cexc field = 10000 _b ) – The invalid operation exception is signaled if an operand is invalid for the operation to be performed. The result, when the exception occurs without a trap, shall be a quiet NaN provided the destination has a floating-point format. The invalid operations are

– Any operation on a signaling NaN,
- Addition or subtraction: Magnitude subtraction of infinities such as (+) + (-) ,
- Multiplication: 0 × ,
- Division: 0/0 or / ,
- Square root if the operand is less than zero,
- Conversion of a binary floating-point number to an integer or decimal format when overflow. infinity, or NaN precludes a faithful representation in that format and this cannot otherwise be signaled,

- Floating-point compare operations: when one or more of the operands are NaN.

■ Division-by-zero (\%fsr's cexc field = 00010 _b ) – If the divisor is zero and the dividend is a finite nonzero number, then the division by zero exception shall be signaled. The result, when no trap occurs, shall be a correctly signed .

■ Overflow (\%fsr's cexc field = 0100 _x_b ) – The exceeded in magnitude by what would have been the rounded floating-point result were the exponent range unbounded. The result, when no trap occurs, shall be determined by the rounding mode and the sign of the intermediate result as follows:

  • Round to nearest carries all overflows to with the sign of the intermediate result,
  • Round toward 0 carries all overflows to the format's largest finite number with the sign of the intermediate result,
  • Round toward - carries positive overflows to the format's largest positive finite number, and carries negative overflows to - ,
  • Round toward + carries negative overflows to the format's most negative finite number, and carries positive overflows to + .

■ Underflow (\%fsr's cexc field = 0010 xb ) – The TSC695F's FPU asserts an underflow exception when the rounded result is inexact and would be smaller in magnitude than the smallest normalized number in the specified format.
Inexact (\%fsr's cexc field = 0xx01
b ) – The inexact exception is generated whenever there is a loss of accuracy (or significance) in the result. The TSC695F's FPU computes results to higher precision than the number of fraction bits in the format. If any of the fraction bits to the right of the LSB was one prior to rounding, the inexact exception is signaled.
■ Unfinished FPop

- The TSC695F's FPU never asserts this exception since all implemented instructions are executed within hardware.

– Data access exception

A data access exception trap is generated if a parity error, uncorrectable EDAC error, access violation, bus timeout or system bus error is detected (MEXC signal is asserted) during the data cycle of any instruction that moves data to or from memory.

- Tag overflow

This trap occurs if execution of a TADDccTV or TSUBccTV instruction causes the overflow bit of the integer condition codes to be set. See the instruction definitions of TADDccTV and TSUBccTV for details.

- Trap instructions

This trap occurs when a Ticc instruction is executed and the trap conditions are met. There are 128 programmable trap types available within the trap instruction trap. See SPARC V7.0 Instruction Set, Ticc instruction for details.

3.6.7.2 Interrupts or Asynchronous Traps

The TSC695F handles 15 asynchronous traps.

It is possible to mask each individual interrupt (except for interrupt 15 – watch-dog) by setting the corresponding bit in the Interrupt Mask Register (INTMKR). The Interrupt Pending Register (INTPDR) reflects the pending interrupts. It is possible to clear pending interrupts by setting the corresponding bit in the Interrupt Clear Register (INTCLR).

The interrupts in the Interrupt Pending Register (INTPDR) are cleared automatically when the interrupt is acknowledged.

By programming the Interrupt Shape Register (INTSHR), it is possible to define the external interrupts to be either active low or active high and to define the external interrupts to be either edge or level sensitive. Also, by programming the Interrupt Shape Register (INTSHR), it is possible to make one of the external interrupts generate a pulse on the EXTINTACK output when the IU acknowledges the interrupt.

Edge sensitive interrupts will be detected only when a transition occurs.

Level sensitive interrupts will be detected as long as the interrupt line is asserted. When the interrupt line is deasserted, the corresponding bit in Interrupt Pending Register (INTPDR) will be cleared

Figure 3-3 Interrupt System Overview
Microchip TSC695F - Interrupts or Asynchronous Traps - 1

flowchart
graph TD
    A["EXTINTACK"] --> B["Reg. INTSHR"]
    B --> C["Glitch removal"]
    C --> D["Shape"]
    D --> E["INTPDR"]
    E --> F["≥1"]
    F --> G["AND"]
    G --> H["Prior"]
    H --> I["Interrupt Request Level to IU"]
    J["EXTINT[4:0"]] --> K["Maskable Internal Interrupts"]
    K --> L["Internal Watchdog"]
    L --> M["10"]
    M --> N["√"]
    N --> O["INTFCR"]
    O --> P["IntTCLR"]
    P --> Q["SYSCTR"]
    Q --> R["INTACK from IU"]
    S["EWDINT"] --> T["Internal Watchdog"]
    U["IWDE"] --> V["SYSCTR"]
    W["Reg. IntTMSK"] --> X["15"]
    Y["Reg. IntTMSK"] --> Z["14"]
    AA["Reg. IntTMSK"] --> AB["15"]
    AC["Reg. IntTMSK"] --> AD["15"]
    AE["Reg. IntTMSK"] --> AF["15"]
    AG["Reg. IntTMSK"] --> AH["15"]
    AI["Reg. IntTMSK"] --> AJ["15"]
    AK["Reg. IntTMSK"] --> AL["15"]
    AM["Reg. IntTMSK"] --> AN["15"]
    AO["Reg. IntTMSK"] --> AP["15"]
    AQ["Reg. IntTMSK"] --> AR["15"]
    AS["Reg. IntTMSK"] --> AT["15"]
    AU["Reg. IntTMSK"] --> AV["15"]
    AW["Reg. IntTMSK"] --> AX["15"]
    AY["ESTPDR Register"] --> AZ["Cleared automatically when the interrupt is acknowledged (INTACK)"]

■ When 'Interrupt test' (it) is not enabled:

  • Setting or clearing a bit in INTFCR register will only affect INTFCR register. The corresponding interrupt will not be forced.
  • When the interrupt is acknowledged, the TSC695F will automatically clear the corresponding bit in the INTPDR register.

■ When 'Interrupt test' (it) is enabled:

  • Setting a bit in INTFCR register will force the corresponding interrupt if it is not masked in INTMKR register.
  • When the interrupt is acknowledged, the TSC695F will automatically clear the corresponding bit in the INTFCR register if this bit is set, otherwise it will clear the corresponding bit in the INTPDR register. In this way no external interrupts are lost.

3.6.8 Timers

In software debug mode the timers are controlled by a system register bit (phlt - bit 4 in Timer Control Register - TIMCTR) and an external pin (DEBUG). Setting the external pin IWDE to V_CC enables the Watchdog Timer. Otherwise the watchdog function must be externally provided.

While the halt mode is active, the timers are temporary halted.

Figure 3-4 Timers Halt
Microchip TSC695F - Timers - 1

flowchart
graph TD
    A["reset"] --> B["Watchdog Timer"]
    C["wd int"] --> B
    D["gpt int"] --> E["General Purpose Timer"]
    F["RTC"] --> G["Real Time Clock Timer"]
    H["rtc int"] --> G
    B --> I["clk enable"]
    E --> J["clk enable"]
    G --> K["clk enable"]
    I --> L["AND Gate"]
    J --> M["AND Gate"]
    K --> N["AND Gate"]
    L --> O["Watchdog Clock"]
    M --> P["Watchdog Clock"]
    N --> Q["SYSCLK"]
    O --> Q
    P --> Q
    Q --> R["TIMCTR (Timer Control Register)"]
    S["015 SYSCTR – (System Control Register)"] --> T["IWDE"]
    S --> U["DEBUG"]
    V["03456731"] --> W["UARTB Halt"]
    V --> X["UARTA Halt"]
    V --> Y["Peripherals Halt"]
    Z["clk enable"] --> G
    AA["clk"] --> G
    AB["clk"] --> G
    AC["clk"] --> G
    AD["clk"] --> G
    AE["clk"] --> G
    AF["clk"] --> G

3.6.8.1 General-purpose Timer

The General-purpose Timer (GPT) provides, in addition to a generalized counter function, a mechanism for setting the step size in which actual time counts are performed (a two-stage counter). This timer/counter pulse generator consists of two parts:

■ pre-SCALER (GPTSR): it is a counter to adjust the step size in which counter does the actual time count.
■ COUNTER (GPTCR): it is a counter to actually count time in steps as set by the value in scaler. The counter is decremented when the scaler reaches zero.

Figure 1. GPT Implementation
Microchip TSC695F - General-purpose Timer - 1

flowchart
graph TD
    A["Set Set"] --> B["Preload"]
    C["SYSCLK"] --> D["Block"]
    B --> E["32-bit Counter16-bit Scaled"]
    D --> F["Control"]
    E --> F
    F --> G["[enable, (periph_halt•DEBUG), load, re-load, hold, stop at zero"]]
    H["Cnt.Cnt."] --> E
    I["GPT Interrupt"] --> E
    J["zero indication"] --> E

GPT is clocked by the internal system clock. The timer is programmable by writing to the Timer Control Register (TIMCTR). They are possible to program to be either of single-shot type or periodical type and in both cases generate an interrupt when the delay time

has elapsed. If the timer is not programmed with a new value when set to periodical type, it restarts from the latest programmed value and continue to count down, thus generating interrupts periodically. It is possible to halt and restart the timers by writing to the Timer Control Register (TIMCTR).

Only the current value of the scaler and counter of the GPT can be read, never the pre-loaded values.

After system reset the Real-time Clock is not running and must be programmed as required.

■ Programming

$$ \begin{array}{l l} \text {if} & \text {scalar 0 > then Timeout = \frac {counter\times(scaler + 1)}{SYSCLK}} \ & \text {if scalar = 0 then Timeout = \frac {counter + 1}{SYSCLK}} \ & \text {Do not program counter = 0} \end{array} $$

■ Behavior – During the ‘1’ → ‘0’ transition, the counter has the value of ‘0’ for one clock cycle and then immediately reloaded. The timeout period is not affected, the reloaded value will be decremented on the next scaler tick as can be expected and generates a timeout period equal to the reload value.

When the scaler is rogrammed to '0', a scaler tick is generated every clock, and the timeout period will be the counter reload value + 1.

Figure 3-5 Timer Behavior Example when Scaler > 0
Microchip TSC695F - General-purpose Timer - 2

text_image Reload mode, Scaler = 1, Counter = 3 SYSCLK Scaler Tick Counter Value 1 2 1 0 3 0 33 0 3 2 Internal INT Timeout Counter x (Scaler+1)

Figure 3-6 Timer Behavior Example when Scaler = 0
Microchip TSC695F - General-purpose Timer - 3

text_image Reload mode, Scaler = 0, Counter = 3 SYSCLK Scaler Tick Counter Value 1 0 3 2 1 0 3 2 1 0 3 Internal INT Timeout Counter+1 Counter+1

3-28 TSC695F User Manual

Microchip TSC695F - General-purpose Timer - 4

Figure 3-7 Timer Behavior Example when Counter = 0
Microchip TSC695F - General-purpose Timer - 5

text_image Initialization of Reload mode, Scaler = 1, Counter = 0 SYSCLK Scaler Tick Counter Value xx(*) reloading with '0' Internal INT Only one INT located during the loading if previous value ≠ 0 load and start command

(*) after reset, counter value = 0xFFFFFFF

3.6.8.2 Real-time Clock Timer

The only functional differences between the two timers are that the Real-time Clock Timer (RTCT) has an 8-bit scaler (16-bit scaler for GPT) and that the RTCT interrupt has higher priority than the GPT interrupt.

RTCT information is available on RTC output pin during 1.5 SYSCLK period.

Figure 3-8 RTCT Implementation
Microchip TSC695F - Real-time Clock Timer - 1

flowchart
graph TD
    A["Set"] --> B["Preload"]
    C["Cnt."] --> D["8-bit Scaler"]
    B --> D
    D --> E["zero indication"]
    E --> F["32-bit Counter"]
    G["Set"] --> H["Preload"]
    I["Cnt."] --> F
    F --> J["×"]
    K["RTC output pin"] --> J
    L["RTC Interrupt"] --> J
    M["Control\n[enable, (periph_halt•DEBUG), load, re-load, hold, stop at zero"]] --> N
    N --> O["SYSCLK"]

Figure 3-9 RTC Pin Functionality
Microchip TSC695F - Real-time Clock Timer - 2

text_image SYSCLK RTC (counter = 1, scaler = 3) or (counter = 2, scaler = 1) RTC (counter = 1, scaler = 2) or (counter = 2, scaler = 0) RTC (counter = 1, scaler = 1 or 0)

3.6.8.3 Watchdog Timer

The watchdog is supplied from a separate external input (WDCLK pin) which must have a frequency which is at least three times lower than SYSCLK. This input is divided by 16 in a prescaler or routed directly to the scaler of the watchdog as set in the System Control Register (wdcs bit in SYSCTR).

The Watchdog Timer Register (WDOGTR) holds the loaded value both in the scaler and in the counter of the watchdog timer.

Figure 3-10 Watchdog Timer States and Transitions
Microchip TSC695F - Watchdog Timer - 1

flowchart
graph TD
    A["WD Init"] -->|Trap Door Set| B["WD Disabled"]
    B -->|WD Program (new value)| C["WD Program (new value)"]
    C -->|WD Timeout Acknowledge (new value)| D["WD Reset Timer Enabled"]
    D -->|Reset Timeout| E["WD Halted"]
    E --> F["Processor RESET"]
    F -->|Interrupt| D
    D -->|WD Timeout| G["WD Program (refresh)"]
    G -->|Trap Door Set| B
    B -->|WD Timeout| D
    D -->|WD Timeout| A

After reset, the timer is enabled and starts running. The default value is the scaler set to maximum and the counter set to maximum. By writing to the Trap Door Set (WDOGST) after system reset, the timer can be disabled. After, a write operation to the Watchdog Timer Register (WDOGTR) starts the timer counting with the value of the Watchdog Timer Register. Note that the Watchdog cannot be disabled once the Watchdog Timer Register (WDOGTR) has been written.

If the timer is refreshed by writing to Watchdog Timer Register (WDOGTR) before the counter reaches zero value, the timer restarts the counting with the new delay value. If the timer is not refreshed (reprogrammed) before the counter reaches zero value, an interrupt is sent. Simultaneously, the timer starts counting a reset timeout period with the programmed delay time. Then, if the timer is acknowledged by writing to Watchdog Timer Register (WDOGTR) with a new programmed value before the reset timeout period elapses again, the timer restarts counting with the new delay value, but if the timer is not acknowledged before the reset timeout period elapses, a reset is applied. This updates the rstc field in the Error and Reset Status Register (ERRRSR).

■ Programming:

$$ \text { Timeout } = 1 6 ^ {\text { w d c s }} \cdot \frac {(\text { scaler } + 1) (\text { counter } + 1)}{W D C L K} $$

$$ \text { ResetTimeout } = \text { Timeout } + 1 6 ^ {\text { wdc } s} \cdot \frac {(\text { scaler } + 1) (\text { resetcounter } + 1)}{\text { WDCLK }} $$

3.6.9 UARTs Two full duplex asynchronous receiver transmitters (UART) are included.

In software debug mode the UARTs are controlled by Timer Control Register bits (phlt, ahlt and bhlt – respectively bit 4/5/6 in TIMCTR) and an external pin (DEBUG). While the halt mode is active, the UARTs are temporarily halted.

Figure 3-11 UARTs Halt
Microchip TSC695F - Watchdog Timer - 2

flowchart
graph TD
    A["TxA"] --> B["UART 'A'"]
    C["RxA"] --> D["UART 'B'"]
    E["TxB"] --> F["UART 'B'"]
    G["RxB"] --> H["UART 'B'"]
    B --> I["clk enable"]
    D --> J["clk enable"]
    I --> K["UARTs Clock"]
    J --> L["UARTs Clock"]
    K --> M["03456731 TIMCTR (Timer Control Registe)"]
    L --> M
    M --> N["bht aht phlt"]
    N --> O["DEBUG"]

The data format of the UARTs is eight bits. It is possible to choose between even or odd parity, or no parity, and between one and two stop bits by programming the System Control Register (SYSCTR). After system reset odd parity and one stop bit are set. The baud rate of the UART is set by programming scalar(us) and ubr fields the System Control Register (SYSCTR). After system reset the baud rate is set to f_SYSCLK divided by 32.

■ Programming

$$ \text { Scaler } (u s) = \frac {\text { Clock }}{3 2 \times 2 \text { audRate } \times \langle 2 - u b r \rangle} - 1 $$

The UARTs provide double buffering, i.e., each UART consists of a transmitter holding register, a receiver holding register, a transmitter shift register, and a receiver shift register. Each of these registers are 8-bit wide. For each UART a RX and TX Register is provided (UARTAR and UARTBR). There is also a common UART Status Register (UARTSR).

To output a byte on the serial output the following procedure should be followed. First, the UART Status Register (UARTSR) should be read in order to check that the transmitter holding register (thea and theb) is empty. Otherwise, the previous byte to be output may be lost (note that the tse bit is not useful for the purpose of checking if a character may be written to the Rx and Tx register). Then, the byte to be output is written in the Rx and Tx register (UARTAR and UARTBR). The byte written will then automatically be transferred to the transmitter send register and converted to serial form also adding start bit, parity bit, and stop bit(s). The above described sequence can be part of a trap handler for the UART interrupt.

A correctly received byte is indicated by the Data Ready bit (dra or drb) in the UART status register (UARTSR). In case of error (framing error, stop bit error, parity error or overrun error), the respective bits fe, pe, and oe are set in the UART status register (UARTSR) but not dra or drb bit.

The UARTs generate an interrupt each time a byte has been received or a byte has been sent. There is another interrupt to indicate errors, but this interrupt is common for both UART channels.

The UART uses an internal clock which is 16 times faster than the baud-rate, and samples each bit 16 times, to ensure error free reception. The clock is derived either from the system clock (SYSCLK) or can use the watchdog clock (WDCLK). This is done by

programming ucs bit in System Control Register – SYSCTR. If WDCLK input is chosen, its frequency must be at least 3 times less than SYSCLK frequency.

The external UART interfaces consist of transmit data output (TxA and TxB) and receive data input (RxA and RxB). Note that no hardware handshake signals, such as CTS or RTS are implemented. Any handshaking must be implemented in software (e.g. using XON/XOFF).

3.6.10 General-purpose Interface

The General-purpose Interface (GPI) is an 8-bit parallel I/O port. Each pin can be configured as an input or an output thanks to the GPI Configuration Register (GPICNFR). When a pin is an input, its state is read from GPI Data Register (GPIDATR). When a pin is an output, its state corresponds to the bit value written in GPI Data Register (GPI-DATR), this value can be re-read in GPI Data Register (GPIDATR).

An edge detection is made on selected GPI inputs. Falling or rising edge is chosen in GPI Configuration Register (GPICNFR). Every input transition on GPI generates an external positive pulse on GPIINT pin of two SYSCLK width.

Figure 3-12 General-purpose Interface
Microchip TSC695F - General-purpose Interface - 1

flowchart
graph TD
    A["I/O[i"] (of GPI Configuration Register - GPICNFR)] --> B["Glitch Removal"]
    B --> C{or Detection}
    C --> D["2 x SYSCLK"]
    D --> E["GPIINT"]
    F["R/F[i"] (of GPI Configuration Register - GPICNFR)] --> G["OR"]
    G --> C
    H["GPI [i"]] --> I["×"]
    I --> J["×"]
    J --> K["×"]
    K --> L["×"]
    L --> M["×"]
    M --> N["×"]
    N --> O["×"]
    O --> P["×"]
    P --> Q["×"]
    Q --> R["×"]
    R --> S["×"]
    S --> T["×"]
    T --> U["×"]
    U --> V["×"]
    V --> W["×"]
    W --> X["×"]
    X --> Y["×"]
    Y --> Z["×"]
    Z --> AA["×"]
    AA --> AB["×"]
    AB --> AC["×"]
    AC --> AD["×"]
    AD --> AE["×"]
    AE --> AF["×"]
    AF --> AG["×"]
    AG --> AH["×"]
    AH --> AI["×"]
    AI --> AJ["×"]
    AJ --> AK["×"]
    AK --> AL["×"]
    AL --> AM["×"]
    AM --> AN["×"]
    AN --> AO["×"]
    AO --> AP["×"]
    AP --> AQ["×"]
    AQ --> AR["×"]
    AR --> AS["×"]
    AS --> AT["×"]
    AT --> AU["×"]
    AU --> AV["×"]
    AV --> AW["×"]
    AW --> AX["×"]
    AX --> AY["×"]
    AY --> AZ["×"]
    AZ --> BA["×"]
    BA --> BB["×"]
    BB --> BC["×"]
    BC --> BD["×"]
    BD --> BE["×"]
    BE --> BF["×"]
    BF --> BG["×"]
    BG --> BH["×"]
    BH --> BI["×"]
    BI --> BJ["×"]
    BJ --> BK["×"]
    BK --> BL["×"]
    BL --> BM["×"]
    BM --> BN["×"]
    BN --> BO["×"]
    BO --> BP["×"]
    BP --> BQ["×"]
    BQ --> BR["×"]
    BR --> BS["×"]
    BS --> BT["×"]
    BT --> BU["×"]
    BU --> BV["×"]
    BV --> BW["×"]
    BW --> BX["×"]
    BX --> BY["×"]
    BY --> BZ["×"]

After Reset, all GPI I/O are configured as inputs.

3.6.11 Execution Modes

3.6.11.1 Reset Mode When the SYSRES

YSRES ____ input is asserted, the TSC695F issues a reset of itself and asserts the RESET output which is intended to be used as a reset signal to all other components in the system. This RESET output has a minimum of 1024 SYCLK width to allow the usage of flash memories.

After the assertion of SYSRES, the processor starts in the 'reset mode', resetting all system registers.

Reset mode is also entered when the RESET output is asserted from any other reason than SYSRES.

  • Software reset which is caused by the software writing to a Software Reset Register.
  • OCD reset.
  • Watchdog reset which is caused by a Watchdog reset timeout.
  • Error reset which is caused by a hardware parity error or an IU error mode.

Error and Reset Status Register contains the source of the last processor reset. OCD reset is seen as SYSRES assertion.

3.6.11.2 Run Mode

In this mode the IU/FPU is executing, all peripherals are running (if software enabled).

3.6.11.3 System Halt Mode

System Halt mode is entered when the SYSHALT input is asserted. The CPUHALT output is asserted, freezing IU/FPU execution. All timers are halted and the UART operation is stopped. When SYSHALT is deasserted, the previous mode is entered.

DMA accesses are allowed during system halt mode, in which DMA has permanent access to the system, i.e., DMAGNT is asserted immediately on DMAREQ.

3.6.11.4 Power-down Mode

This mode is entered by writing to the Power-down Register (PDOWN). Then the bus arbiter removes the bus ownership from the IU. prd bit in the System Control Register (SYSCTR) must be programmed prior to entering power-down mode.

DMA accesses are allowed during power-down mode.

The TSC695F leaves the power-down mode if an external interrupt is asserted.

3.6.11.5 Error Halt Mode

Error Halt mode is entered under the following circumstances:

– A internal hardware parity error.
- The IU enters error mode.

In Error Halt mode, the CPUHALT and SYSERR outputs are asserted (note that SYSERR is also asserted if a masked error occurs even though Error Halt mode is not entered in this case). All timers are halted and the UART operation is stopped in this mode. The only way to exit Error Halt Mode is through Cold Reset by asserting SYSRESET.

The TSC695F allows DMA accesses during error halt mode.

3.6.12 Error Handler

The TSC695F has one error output signal (SYSERR) which indicates that an unmasked error has occurred. Any error signalled on the error inputs from the IU and the FPU is latched and reflected in the Error and Reset Status Register (ERRRSR). It is possible to program an error mask in the System Control Register (SYSCTR) for each type of error (excepted for FPU) in order to determine whether the specific error shall lead to the processor ignoring the error or asserting a processor halt or processor reset (programming the System Control Register – SYSCTR). As default, an error leads to a processor halt. All unmasked errors, asserts the SYSERR pin and this pin is asserted until all the unmasked error bits in the Error and Reset Status Register (ERRRSR) are cleared.

Figure 3-13 Error Handler Schematic
Microchip TSC695F - Error Handler - 1

flowchart
graph TD
    subgraph IU
        A["error mode"] --> B["(trap in trap)"]
        C["internal parity checkers"] --> D["Trap 0x61"]
        C --> E["Trap 0x62"]
        C --> F["Trap 0x63"]
        C --> G["Trap 0x64"]
        H["register file checkers"] --> I["Trap 0x65"]
        J["async."] --> K["trap handler"]
        L["register file checkers"] --> M["0x08"]
        N["internal parity checkers"] --> M
        O["other sources"] --> P["or"]
        Q["IFUERR pin"] --> R["IIU Error Mode"]
        S["FPU Hardware Error"] --> T["FPU Hardware Error"]
        U["system hardware error"] --> V["system hardware error"]
        W["memory control"] --> X["interrupt Request Level [3:0"]]
        Y["interrupt Acknowledge"] --> Z["interrupt System"]
        AA["EXINT[4:0"] pins] --> AB["and"]
        AC["SYSERR pin"] --> AD["or"]
        AE["Masked HW error"] --> AF["other sources"]
        AG["iuemmsk"] --> AH["iuem"]
        AH --> AI["iuhemsk"]
        AI --> AJ["rhiuhe"]
        AJ --> AK["syshemsk"]
        AK --> AL["rhsyshe"]
        AM["iue"] --> AN["iuhe"]
        AN --> AO["fpuhe"]
        AO --> AP["syshe"]
        AQ["ERRRSRMEXO pin"] --> AR["sysCTR"]
        AS["RESET HALT"] --> AT["AND"]
    end
    subgraph System
        AU["SYSTEM"] --> AV["AND"]
        AW["SYSTEM"] --> AX["AND"]
        AY["SYSTEM"] --> AZ["AND"]
        BA["SYSTEM"] --> BB["AND"]
        BC["SYSTEM"] --> BD["AND"]
        BE["SYSTEM"] --> BF["AND"]
        BG["iuemmsk"] --> BH["iuem"]
        BI["iuhemsk"] --> BJ["rhiuhe"]
        BK["syshemsk"] --> BL["rhsyshe"]
        BM["iue"] --> BN["iuhe"]
        BO["iue"] --> BP["iuhemsk"]
        BQ["iue"] --> BR["rhiuhe"]
        BS["iue"] --> BT["syshemsk"]
        BU["iue"] --> BV["rhsyshe"]
    end
    IU --> J
    IU --> K
    IU --> L
    IU --> M
    IU --> N
    IU --> AB
    IU --> AF
    IU --> AG
    IU --> AS
    IU --> AL
    IU --> BT
    IU --> BA
    IU --> BB
    IU --> AF
    IU --> AG
    IU --> BA
    IU --> BB
    IU --> AF
    IU --> BB
    IU --> BB
    IU --> BB
    IU --> BB
    IU --> BB
    IU --> BB
    IU --> BB
    IU --> BB
    IU --> BB
    IU --> BB
    IU --> BB
    IU --> BB
    IU --> BB
    IU --> BB
    IU --> BB
    IU --> BB
    IU --> BB
    IUIR pin --> R
    Memory Exception --> S
    Memory Exception --> T
    Memory Exception --> U
    Memory Exception --> V
    Memory Exception --> W
    Memory Exception --> X
    Memory Exception --> Y
    Memory Exception --> Z
    Memory Exception --> AA
    Memory Exception --> AB
    Memory Exception --> AC
    Memory Exception --> AD
    Memory Exception --> AE
    Memory Exception --> AF
    Memory Exception --> AG
    Memory Exception --> AH
    Memory Exception --> AI
    Memory Exception --> AJ
    Memory Exception --> AK
    Memory Exception --> AL
    Memory Exception --> AM
    Memory Exception --> AN
    Memory Exception --> AO
    Memory Exception --> AP
    Memory Exception --> AQ
    Memory Exception --> AR

3.6.13 Parity Checking

The TSC695F includes parity checking and generation if required on the external data bus (DPAR pin). It includes parity checking on the external address bus (RAPAR pin). It also includes parity checking on ASI and SIZE (RASPAR pin) together with parity generation and checking on all system registers. The TSC695F also includes parity generation and checking on the internal control bus to the IU (CPAR pin). If a parity error is detected on the external data bus, the external address, the external RASI and RSIZE, the internal control bus, a memory exception is asserted. If a memory exception event occurs the System Fault Status Register (SYSFSR) is updated and reflects the type and location of parity errors.

All external parity checking can be disabled using the NOPAR signal.

3.6.14 System Clock

The TSC695F uses CLK2 clock input directly and creates a system clock signal by dividing CLK2 by two. It drives SYSCLK pin with a nominal 50% duty cycle for the application. Some output signals are clocked by the CLK2 negative edge which means that the CLK2 duty cycle has a direct impact on the system performance.

When interfacing peripherals (I/O interface, DMA interface, etc.) it is highly recommended that only SYSCLK rising edge is used as reference as far as possible.

3.6.15 System Availability

The sysav bit in the Error and Reset Status Register (ERRRSR) can be used by software to indicate system availability. The sysav bit is cleared by reset and is programmable by software. Note that the SYSAV output signal is asserted only if the sysav bit is set and SYSERR is deasserted, i.e., no error has been detected.

3.6.16 Test Mode

The TSC695F includes a number of software test facilities such as EDAC test, Parity test, Interrupt test, Error test and a simple Test Access Port. These test functions are controlled using the Test Control Register (TESCTR).

Note that TMode[1:0] pins are only dedicated for factory test. These pins must be kept grounded.

3-34 TSC695F User Manual

Microchip TSC695F - 3-34 TSC695F User Manual - 1

3.7 Test and Diagnostic Hardware Functions

A variety of TSC695F test and diagnostic hardware functions, including boundary scan, internal scan, clock control and On-chip Debugger, are controlled through an IEEE 1149.1 (JTAG) standard Test Access Port (TAP). Commands and data are sent as serial data between the JTAG master and the TSC695F (a JTAG slave), via a 4 wire serial testability bus (JTAG bus).

3.8 Test Access Port

3.8.1 TAP Interface

The TAP interfaces to the JTAG bus via 5 dedicated pins on the TSC695F chip. These pins are:

Table 3-7. TAP Signals

Pin NameType Description
TCK TestClock Input Used to clock serial data into scan latches and control sequence of the test state machine.TCK can be asynchronous with CLK2 and SYSCLK.
TMS TestMode SelectInput Primary control signal for the state machine. Synchronous with TCK. A sequence of values on TMS adjusts the current state of the TAP.
TDITest Data InputInputSerial input data to the scan latches. Synchronous with TCK.
TDOTest Data OutputOutputSerial output data from the scan latches. Synchronous with TCK.
TRSTTest ResetInputResets the test state machine. can be asynchronous with TCK.

Note: For more details on the IEEE protocol, please refer to the IEEE document 'IEEE Standard Test Access Port and Boundary-scan Architecture'.

3.8.2 Board Level Architecture

Any TSC695F-based system will contain several JTAG compatible chips. These are connected using the minimum (single TMS signal) configuration as described in Figure 3-14. This configuration contains three broadcast signals (TMS, TCK, and TRST) which are fed from the JTAG master to all JTAG slaves in parallel, and a serial path formed by a daisy-chain connection of the serial test data pins (TDI and TDO) of all slaves. The TAP supports a BYPASS instruction which places a minimum shift path (1 bit) between the chip's TDI and TDO pins. This allows efficient access to any single chip in the daisy-chain without board-level multiplexing.

Figure 3-14 JTAG – Serial Connection Using 1 TMS Signal
Microchip TSC695F - Board Level Architecture - 1

flowchart
graph LR
    A["TDI"] --> B["Part 1: TDI TDO"]
    B --> C["Part 2: TDI TDO"]
    C --> D["Part 3: TDI TDO"]
    D --> E["Part n: TDI TDO"]
    F["TMS"] --> G["TrST"]
    H["TCK"] --> I["TrST"]
    J["TRST"] --> K["TrST"]
    B --> L["TMS TCK TRST"]
    C --> M["TMS TCK TRST"]
    D --> N["TMS TCK TRST"]
    E --> O["TMS TCK TRST"]
    style A fill:#f9f,stroke:#333
    style F fill:#ccf,stroke:#333
    style H fill:#ccf,stroke:#333
    style J fill:#ccf,stroke:#333
    style B fill:#dfd,stroke:#333
    style C fill:#dfd,stroke:#333
    style D fill:#dfd,stroke:#333
    style E fill:#dfd,stroke:#333
    style F fill:#dfd,stroke:#333
    style G fill:#dfd,stroke:#333
    style H fill:#dfd,stroke:#333
    style I fill:#dfd,stroke:#333
    style J fill:#dfd,stroke:#333
    style K fill:#dfd,stroke:#333

3.8.3 TAP Architecture

The TAP implemented in the TSC695F consists of a TAP interface, a TAP controller, plus a number of shift registers including an instruction register (IR) and multiple data registers (DR).

Figure 3-15 JTAG - TSC695F TAP Architecture
Microchip TSC695F - TAP Architecture - 1

flowchart
graph TD
    subgraph Inputs
        TDO --> TDI
        TDI --> TAP
        TAP --> TAPController
        TAPController --> TAP
        TAPController --> TMS
        TAPController --> TCK
        TAPController --> TRST
    end

    subgraph Outputs
        IU Scan Register --> FPU Scan Register
        FPU Scan Register --> System Scan Register
        System Scan Register --> Checkers Scan Register
        Checkers Scan Register --> OCD_Ctrl/Stat_Register_OCD_Scan_Register
        OCD_Ctrl/Stat_Register --> Boundary_Scan_Register
        Boundary_Scan_Register --> Device_ID_Register
        Device_ID_Register --> Bypass_Register
        Bypass_Register --> Test_Data_Registers
        Test_Data_Registers --> Mux
        Mux --> 0_1["0"]
        Mux --> D_Q["D"]
        D_Q --> EN["EN"]
        EN --> ENa_TDO["Ena TDO"]
    end

    TAP --> TAPController
    TAPController --> TMS
    TAPController --> TCK
    TAPController --> TRST

    Clock_DR --> Reset
    Shift_DR --> Reset
    Update_DR --> Reset
    Clock_IR --> Reset
    Shift_IR --> Reset
    Update_IR --> Reset

    Instruction_Register --> Select
    Instruction_Register --> Design-Specific_Data["Design-Specific Data"]
    style Input fill:#f9f,stroke:#333
    style Output fill:#ccf,stroke:#333

3.9 TAP Controller

The TAP controller is a synchronous finite state machine (FSM) which controls the sequence of operations of the JTAG test circuitry, in response to changes at the JTAG bus. (Specifically, in response to changes at the TMS input with respect to the TCK input.)

3.9.1 TAP Controller FSM

The TAP controller FSM implements the state (16 states) diagram as detailed in Figure 3-16. The IR is a 6-bit register which allows a test instruction to be shifted into the TSC695F. The instruction selects the test to be performed and the test data register to be accessed. The supported instructions are listed in Section 3.10.1. Although any number of loops may be supported by the TAP, the finite state machine in the TAP controller only distinguishes between the IR and a DR. The specific DR can be decoded from the instruction in the IR.

Figure 3-16 JTAG – TAP Controller State Machine
Microchip TSC695F - TAP Controller FSM - 1

flowchart
graph TD
    A["Test Logic Reset"] -->|0| B["Run Test/Idle"]
    C["0"] --> B
    B -->|1| D["Select DR Scan"]
    D -->|0| E["Capture DR[1"]]
    E -->|0| F["Shift DR"]
    F -->|1| G["Exit_1 DR"]
    G -->|0| H["Pause DR"]
    H -->|1| I["Exit_2 DR"]
    I -->|1| J["Update DR[1"]]
    J -->|1| K["Output"]
    D -->|1| L["Select IR Scan"]
    L -->|0| M["Capture IR[1"]]
    M -->|0| N["Shift IR"]
    N -->|1| O["Exit_1 IR"]
    O -->|0| P["Pause IR"]
    P -->|1| Q["Exit_2 IR"]
    Q -->|1| R["Update IR[1"]]
    R -->|1| S["Output"]
    style A fill:#f9f,stroke:#333
    style C fill:#f9f,stroke:#333
    style D fill:#ccf,stroke:#333
    style L fill:#ccf,stroke:#333
    style M fill:#ccf,stroke:#333
    style N fill:#ccf,stroke:#333
    style O fill:#ccf,stroke:#333
    style P fill:#ccf,stroke:#333
    style Q fill:#ccf,stroke:#333
    style R fill:#ccf,stroke:#333
    style S fill:#ccf,stroke:#333

Note: 1. Due to the scan cell layout, 'Capture DR' and 'Update DR' are states without associated action during the scanning of internal chains.

3.10 The Instruction Register

3.10.1 List of Instructions
The instruction listed below are supported by the TSC695F TAP. The table contains the bit-value and mnemonic, as well as which data register is selected by that instruction.

Binary Value Instruction NameDataRegisterScanChain Accessed
01.1000CCTESTCheckers Scan RegisterIU parity checkers scan chain
01.1100IUTESTIU Scan RegisterIU registers scan chain
01.1101FPUTESTFPU Scan RegisterFPU registers scan chain
01.1110SYSTESTSystem Scan RegisterSystem registers scan chain
01.1010OCDTESTOCD Scan RegisterOCD registers scan chain
01.1001CTSTESTOCD Ctrl/Stat Register[2]OCD control/status scan chain
00.0000[1]EXTESTBoundary Scan RegisterBoundary scan chain
00.0001[1]SAMPLE/PRELOADBoundary Scan RegisterBoundary scan chain
00.0011INTESTBoundary Scan RegisterBoundary scan chain
11.1111[1]BYPASSBypass Register[2]Bypass register
10.0000IDCODEDevice ID Register[2]ID register scan chain

Notes: 1. Encoding fixed by IEEE JTAG protocol.

  1. Data register can be accessed SYSCLK (CLK2) running

3.10.2 Mandatory Instructions

■ BYPASS instruction binary coded '11.1111'

- It is used to speed up shifting at board level through components that are not to be activated.

■ EXTEST instruction binary coded '00 . 0000'

- It is used to test connections between components at board level. Components output pins are controlled by boundary scan register during Capture DR on the rising edge of TCK.

■ SAMPLE/PRELOAD instruction binary coded '00 . 0001'

- It is used to get a snapshot of the normal operation by sampling I/O states during Capture DR on the rising edge of TCK. It allows also to preload a value on the output latches during Update DR on falling edge of TCK. It does not modify system behavior.

3.10.3 Defined Optional Instructions

■ INTEST instruction binary coded '00 . 0011'

- Used to achieve testing of on-chip logic on the board. Data are shifted through boundary scan register and applied to logic inputs during Update DR. Outputs are sampled into the boundary scan register during Capture DR.

■ IDCODE instruction binary coded '10 . 0000'

– Value of the IDCODE is loaded during Capture DR.

3.10.4 Owner Instructions

■ CCTEST instruction binary coded '01.1000'

- It is a factory test to verify parity checkers in IU internal block.

■ IUTEST instruction binary coded '01.1100'

– Used to access to the User's IU Register.

■ FPUTEST instruction binary coded '01.1101'

- Used to access to the User's FPU Register.

■ SYSTEST instruction binary coded '01.1110'

– Used to access to the User's System Register.

■ OCDTEST instruction binary coded '01.1010'

- Used to access to the OCD resources as hardware break-points and cycle-counter.

■ CTSTEST instruction binary coded '01.1001'

– Used to access to OCD control and status bits.

3.11 Test Data Registers

The following data registers are supported in the TSC695F TAP.

3.11.1 Bypass Register

Bypass register containing a single shift register stage is connected between TDI and TDO.

3.11.2 Device ID Register ID register is a read only 32-bit register.

Figure 3-17 TSC695F ID Register Contents

31 28 2712 111 0
Vers. Part ID Manufacturer's ID Const.
00001011.0110.0100.01000000.1011.0001

■ ID. register value: 0x 0b64 40b1
■ Field Definitions:

  • [31:28]: Vers - Version number - 0x 0
  • [27:12]: Part ID - Represent part number as assigned by Vendor - 0x b644
  • [11:01]: Manufacturer's ID - Represent manufacturer's ID as per JEDEC - 0x 058
  • [0]: Const - Constant tied to logic '1'.

Device ID register is connected between TDI and TDO.

3.11.3 Boundary Scan Register

A single scan chain consisting of all of the boundary scan cells (input, output and in/out cells) excepted TAP interface pins.

■ The initial purpose of the boundary-scan is the support of scan-based board testing.
In the On-chip Debugger environment, the boundary scan allows an external memory access, memory controlled by the TSC695F. This access type can be used for program download or patch, data area initialization, data area dump and I/O control.

Boundary-scan register is connected between TDI and TDO.

3.11.4 Checkers Scan Register

A single scan chain consisting of all of the scan cells of IU parity checkers. The checkers scan is only used for factory test.

Checkers scan register is connected between TDI and TDO.

3.11.5 IU Scan Register

A single scan chain consisting of all of the scan cells of IU user's registers.

In the On-chip Debugger environment, the IU scan allows an internal access to the following IU user's registers:

%psr
%tbr
■ %wim
■ %y
■ windowed registers (# 128)
■ %g0 up to %g7 (%g0 always 0x 0000 0000)
■ buried program counter registers: Fetch, Decode, Execute and Write PC (i.e., %pc, %npc)

Note: All windowed registers can be read or written by the OCD even if theses registers are not in the current window.

IU Scan register is connected between TDI and TDO.

3.11.6 FPU Scan Register

A single scan chain consisting of all of the scan cells of FPU registers.

In the On-chip Debugger environment, the FPU scan allows an internal access to the following PPU user's registers:

%fsr
%fpQueue
■ %f0 up to %f31

FPU Scan register is connected between TDI and TDO.

3.11.7 System Scan Register

A single scan chain consisting of all of the scan cells of System registers.

In the On-chip Debugger environment, the System scan allows an internal access to the following System user's registers:

■ System Control Register
■ Software Reset Register
■ Power-down Register
■ Memory Configuration Register
■ I/O Configuration Register
■ Waitstate Configuration Register
■ Access Protection Segment 1 Base Register
■ Access Protection Segment 1 End Register
■ Access Protection Segment 2 Base Register
■ Access Protection Segment 2 End Register
■ Interrupt Shape Register
■ Interrupt Pending Register
■ Interrupt Mask Register
■ Interrupt Clear Register
■ Interrupt Force Register
■ Watchdog Program and Timeout Acknowledge Register
■ Watchdog Trap Door Set
■ Real-time Clock Timer
■ Real-time Clock Timer Program Register
■ Real-time Clock Timer
■ Real-time Clock Timer Program Register
■ General-purpose Timer
■ General-purpose Timer Program Register
■ General-purpose Timer
■ General-purpose Timer Program Register

■ Timer Control Register
■ System Fault Status Register
■ Failing Address Register
■ Error and Reset Status Register
■ Test Control Register
■ UART 'A' Rx and Tx Register
■ UART 'B' Rx and Tx Register
■ UART Status Register
■ GPI Direction Register
■ GPI Status Register

To each user's register, one parity bits is associated.

Note: Read-only user's registers can be read or written.

System Scan register is connected between TDI and TDO.

3.11.8 OCD Scan Register

A single scan chain consisting of all of the scan cells of OCD breakpoint and cycle-counter registers.

In the On-chip Debugger environment, the OCD scan allows the only access to the following OCD resources:

■ Address, enable and 8-bit occurrence counter of breakpoint-1 for program execution
■ Address, enable and 8-bit occurrence counter of breakpoint-2 for program execution
■ Address, enable and 8-bit occurrence counter of breakpoint-3 for program execution
■ Upper address, lower address, data, data mask, enable, qualifiers, qualifiers mask and 8-bit occurrence counter of breakpoint for data memory

■ Enable and 24-bit cycle counter

■ Enable Step-by-step Mode

OCD Scan register is connected between TDI and TDO.

3.11.9 OCD Control and Status Register

A single scan chain consisting of all of the scan cells of OCD control and status register.

In the On-chip Debugger environment, the OCD control and status scan allows the only access to the following OCD controls:

■ Reset Request
■ Freeze Request
■ Run (or Step-by-step)

and status:

■ Reset (image of RESET output pin)

■ Freeze Grant

■ System Halt (image of SYSHALT input pin)

OCD Scan register is connected between TDI and TDO.

3.12 On-chip Debugger Resources

3.12.1 Hardware Breakpoints

The ODC provides 4 hardware Break-points, 3 for program execution and 1 for data memory. When a breakpoint condition is true, a break occurs and the internal clock is frozen. It is then possible for an external monitoring system to know whether the processor is running or not thanks to SYSCLK and CPUHALT pins. The Run command resumes from a break. Each hardware breakpoint includes an internal 8-bit event counter that allows to break onto the 1^st to the 255^th break condition match.

■ Break-point for Program Execution

- A hardware breakpoint for program execution is defined by an breakpoint address register. This register value is compared to the Program Counter at the execution stage of the pipeline. When a break occurs, the instruction is not executed.

Figure 3-18 Breakpoint for Program Execution Block Diagram
Microchip TSC695F - ■ Break-point for Program Execution - 1

flowchart
graph TD
    E["Input E"] --> BreakpointAddress["Breakpoint Address"]
    BreakpointAddress --> CountOccurrence["Count (occurrence) = 1"]
    CountOccurrence --> BreakpointRegister["Breakpoint Register"]
    BreakpointRegister --> Breakpoint
    Enable["Enable"] --> AddressPipeClock["Address Pipe Clock (≈ SYSCLK)"]
    AddressPipeClock --> D["AND Gate"]
    AddressPipeClock --> R["AND Gate"]
    D --> CounterD["8-bit decounter"]
    CounterD --> CounterR["AND Gate"]
    CounterR --> D
    CounterR --> CounterD
    CounterD --> fromOtherBreakpoints["from other breakpoints"]
    fromOtherBreakpoints --> Breakpoint

■ Breakpoint for Data Memory

  • A hardware breakpoint for data memory works with the informations of the address, data, ASI busses.
  • It is possible to break onto an address range thanks to two comparison address registers: one low limit address register and one high limit address register
  • The break condition on the data is given by a data comparison register and a data mask register.
  • The last break condition uses one of the following access type qualifier: read/write/code/data/user space/supervisor space and a qualifier mask register.

Figure 3-19 Breakpoint for Data Memory Block Diagram
Microchip TSC695F - ■ Breakpoint for Data Memory - 1

flowchart
graph TD
    A["E"] --> B["Breakpoint Up.Add"]
    A --> C["Breakpoint Lw.Add"]
    B --> D["32"]
    C --> E["32"]
    D --> F["RA [31:0"]]
    E --> G["≥"]
    F --> H["D [31:0"]]
    G --> I["32"]
    H --> J["Mask Data"]
    I --> K["32"]
    J --> L["Mask Access"]
    K --> M["5"]
    L --> N["5"]
    M --> O["Count (occurrence)"]
    N --> O
    O --> P["8-bit decounter = 1"]
    P --> Q["from other breakpoints"]
    Q --> R["Breakpoint"]
    R --> S["Clock (≈ SYSCLK)"]
    S --> T["Enable"]
    T --> U["AND Gate"]
    U --> V["D"]
    V --> W["R"]
    W --> X["Output"]
    style A fill:#f9f,stroke:#333
    style O fill:#ccf,stroke:#333

Table 3-8. Breakpoint for Data Memory – Access Types

Size BitPosition Bit Value Function
5bit 0 (= signal)'0' Write access
'1' Read access
bit 1 (= RASI[0])'0' User access
'1' Supervisor access
bit 2 (= RASI[1])'0' Instruction access
'1' Data access
bit 4,3 (= RASI[4,3])Must remain at '10'

Figure 3-20 Breakpoint for Data Memory – Masks

Mask TypeSizeFunction
A bit to '0' indicates the associated data or access bit is compared.A bit to '1' indicates the associated data or access bit is ignored during the comparison.
Mask Data32bit 0Mask bit for D[0]
.........
bit 32 Mask bit for D[32]
Mask Access5bit 0Mask bit for read or write access
bit 4;1Mask bit for RASI[3;0]

3.12.2 Processor Reset

The JTAG on-chip emulator can reset the microprocessor. This reset is the same reset that occurs when asserting the Reset input signal.

3.12.3 Cycle Counter

The internal register CYC_CNT (only accessed under OCD mode) gives the number of elapsed clock cycles between a 'Run' and an 'Freeze'. An associated 24-bit counter allows to measure elapse time up to 840ms at 20 MHz. CYC_CNT register can be reset or held between during a 'Freeze' phase.

3.12.4 Freeze/Run

Freeze command freezes the internal clock. All peripherals are frozen. All the on-chip debugger commands are available.

Run is used to resume from Freeze state (due to Freeze command or a breakpoint occurrence).

3.12.5 Step-by-step

The step-by-step command allows to execute a single execute instruction.

4.1 IU Registers

Table 4-1. Register Legend

bit number313029282726252423222120191817161514
field name fieldreserved (0x 00) [0x00 = read value and value to be written]
bit name b1 b2 b3 b4
access typer = read access w =write access r/w = read and write access
default value after RESET011010x = undefined or non affected by RESET

4.2 Processor State Register

Table 4-2. Processor State Register (PSR)

313029282726252423222120191817161514131211109876543210
implvericcreserved (00 0000)efpilspsetcwp
nzvc
rrr/wr/wr/wr/wr/wrr/wr/wr/wr/wr/w
00010001x00 0000x1x0x

■ impl – IU Implementation

- The implementation number for the TSC695F IU is 0001_b .

■ ver – IU Version

- The current version number for the TSC695F IU is 0001_b .

■ icc – IU Condition Codes

- This field is modified by arithmetic and logical instructions whose names end with the letters cc (for example, ANDcc), and can be overwritten by the writing PSR instruction. The Bicc and Ticc instructions base their control transfer on these bits, which are defined as follows:

■ n - Negative

  • n bit indicates whether the ALU result was negative for the last icc-modifying instruction.
  • 0 = not negative
  • 1 = negative

■ z-Zero

  • z bit indicates whether the ALU result was zero for the last icc-modifying instruction.
  • 0 = result was nonzero
  • 1 = result was zero

■ v-oVerflow

  • v bit indicates whether an arithmetic overflow occurred during the last icc-modifying instruction. The overflow bit is also set if a tagged operation (TADDcc, TSUBcc, etc.) is performed on non-tagged operands. Logical instructions that modify the icc field always set the overflow bit to 0.
  • 0 = arithmetic overflow did not occur
  • 1 = arithmetic overflow did occur

■ c - Carry

  • c bit indicates whether an arithmetic carry out of result bit 31 occurred from the last icc-modifying addition or if a borrow into bit 31 resulted from the last icc-modifying subtraction. Logical instructions that modify the icc field always set the carry bit to 0.
  • 0 = a carry/borrow did not occur
  • 1 = a carry/borrow did occur

Reserved

- A WRPSR should write only 0's to this field (note: ec bit = 0, coprocessor is not available).

■ ef – Enable Floating-point Unit

  • 0 = FPU disabled
  • 1 = FPU enabled

  • If the FPU is either disabled or enabled but not present, an FPop, FBfcc, or floating-point load/store instruction will cause a floating-point-disabled trap. When disabled, the FPU retains that state until it is re-enabled or reset. Even when disabled, it can continue to execute any instructions in its queue.

  • ef bit can be used by the programmer to control FPU use when running multiple processes. By disabling the ef bit while running a process that doesn't require the FPU, software would not have to save and restore the FPU's registers across context switches. If the FPU is not present, as signaled by the input signal, FP, the ef bit can be used to provoke floating-point instruction set emulation by generating a floating-point-disabled trap if execution of a floating-point instruction is attempted. This technique may be used with the co-processor as well.

■ pil – Processor Interrupt Level

- pil field identifies the processor's external interrupt priority level. The processor will only accept asynchronous interrupts whose interrupt level (i.e INT level in 'TSC695F - Errors, Traps and Priority Assignments' table) is greater than the value in pil. Bit 11 of the pil field is the MSB and bit 8 is the LSB.

■ s – Supervisor

  • s bit determines whether the processor is in supervisor or user mode. Because WRPSR is privileged and only available in the supervisor mode, supervisor mode can only be entered by a software or hardware trap.
  • 0 = user mode
  • 1 = supervisor mode

■ ps – Previous Supervisor

- ps bit holds the value that was in the s bit at the time the most recent trap was taken. ps bit is the only PSR bit that cannot be restored, it is overwritten when the trap is taken.

■ et – Enable Traps

  • et bit determines whether traps are enabled. If traps are disabled, all asynchronous traps are ignored. If a synchronous or floating-point trap occurs while traps are disabled, the IU halts and enters the error mode.
  • 0 = traps disabled
  • 1 = traps enabled
  • If it is necessary for the software to manually disable traps, care must be taken when changing the et bit from enabled ( et = 1 ) to disabled ( et = 0 ), since the RDPSR, WRPSR instruction sequence is interruptible. One way to handle that is to write all interrupt trap handlers so that before they return program control to the supervisor software that was interrupted, they restore the PSR to the value it had before the interrupt was taken. This will guarantee a correct result when the interrupted RDPSR, WRPSR sequence continues.

An alternative to the RDPSR-WRPSR sequence is to generate a 'trap instruction' trap with a Ticc instruction. A taken trap automatically sets et to 0, disabling further traps.

■ cwp – Current Window Pointer

- cwp field contains a pointer to the currently active register file window. cwp is decremented by traps and the SAVE instruction, and is incremented by RESTORE and RETT instructions.

4.3 Window Invalid Mask

Table 4-3. Window Invalid Mask (WIM)

313029282726252423222120191817161514131211109876543210
'future expansion for additional windows' (0x 00 0000)
r

Table 4-3. Window Invalid Mask (WIM) (Continued)

313029282726252423222120191817161514131211109876543210
xx

This register designates which window(s) will cause generation of an underflow or overflow trap when pointed to by the cwp as the result of a SAVE, RESTORE, or RETT instruction.

Each bit in the WIM register corresponds to a window; if a bit is set to 1, the window corresponding to that bit is marked as invalid. If a SAVE, RESTORE, or RETT instruction would cause the cwp to point to a window whose WIM bit equals 1, a window overflow (SAVE) or window underflow (RESTORE, RETT) trap is generated. The trap handler uses the local registers of the invalidated window.

A WIM bit is usually set by the operating system software to identify the boundary between the oldest and newest window. The overflow or underflow trap prevents previous windows from being overwritten or restores previous windows from memory. WIM can also be used to mark off register banks for fast context switching.

WIM is read by the RDWIM instruction, and written by the WRWIM instruction.

4.4 Trap Base

Register

Table 4-4. Trap Base Register (TBR)

313029282726252423222120191817161514131211109876543210
trap base address (tba) trap type (tt) '0' '0' '0' '0'
r/w r
x 0000

When a trap occurs, the program counter (PC) is loaded with the contents of the trap base register. The TBR contains two fields that together constitute a pointer into the trap table, which in turn contains the trap handler address. RDTBR can read the entire register; however, the WRTBR instruction can write only to the Trap Base Address field. The Trap Type field can be directly manipulated using the Ticc instruction.

■ tba – Trap Base Address

- tba field contains the most-significant 20 bits of the trap table address. This field applies to all trap types except reset, which forces address 0. The tba is software controlled.

■ tt - Trap Type

- tt field comprises the Trap Type field, an eight-bit value that provides an offset into the trap table based on the type of trap being taken. This field retains its value until the next trap is taken.

4.5 Y Register

Table 4-5. Y Register (Y)

313029282726252423222120191817161514131211109876543210
y

4-54 TSC695F User Manual

Microchip TSC695F - Y Register - 1

Table 4-5. Y Register (Y)

313029282726252423222120191817161514131211109876543210
r/w
x

The Y register is used by the instruction set to create 64-bit products, overflow, flags, etc. This register is read and written using the non-privileged RDY and WRY instructions.

4.6 Window

Registers

Table 4-6. Window Registers

Type Name Definition Reg. nbr
ini7 return address r31
fp frame pointer r30
i5 incoming parameter reg 5 r29
i4 incoming parameter reg 4 r28
i3 incoming parameter reg 3 r27
i2 incoming parameter reg 2 r26
i1 incoming parameter reg 1 r25
i0 incoming parameter reg 0 r24
localI7local reg 7r23
I6local reg 6r22
I5local reg 5r21
I4local reg 4r20
I3local reg 3r19
I2nPC (for RETT) r18
I1PC (for RETT) r17
I0local reg 0r16
outo7tempr15
sp stack pointerr14
o5outgoing parameter reg 5r13
o4outgoing parameter reg 4r12
o3outgoing parameter reg 3r11
o2outgoing parameter reg 2r10
o1outgoing parameter reg 1r9
o0outgoing parameter reg 0r8
Type Name DefinitionReg. nbr
globalg7 globalreg 7 r7
g6 globalreg 6 r6
g5 globalreg 5 r5
g4 globalreg 4 r4
g3 globalreg 3 r3
g2 globalreg 2 r2
g1 globalreg 1 r1
g0 0x 0000 0000 r0

For each window register:

313029282726252423222120191817161514131211109876543210
...
r/w
x (0x 0000 0000 for g0)

Figure 4-1. Overlapping Windows
Microchip TSC695F - Registers - 1

flowchart
graph TD
    A["w0 locals"] --> B["w1 locals"]
    B --> C["w2 locals"]
    C --> D["w3 locals"]
    D --> E["w4 locals"]
    E --> F["w5 locals"]
    F --> G["w6 locals"]
    G --> H["w7 locals"]
    H --> I["w8 locals"]
    I --> J["w9 locals"]
    J --> K[" Globals "]
    style A fill:#f9f,stroke:#333
    style B fill:#f9f,stroke:#333
    style C fill:#f9f,stroke:#333
    style D fill:#f9f,stroke:#333
    style E fill:#f9f,stroke:#333
    style F fill:#f9f,stroke:#333
    style G fill:#f9f,stroke:#333
    style H fill:#f9f,stroke:#333
    style I fill:#f9f,stroke:#333
    style J fill:#f9f,stroke:#333
    style K fill:#f9f,stroke:#333
    subgraph "Restore"
        L["w0"] --> M["w1"]
        N["w2"] --> O["w3"]
        P["w4"] --> Q["w5"]
        R["w6"] --> S["w7"]
    end
    subgraph "Save"
        T["w0"] --> U["w1"]
        V["w2"] --> W["w3"]
        X["w4"] --> Y["w5"]
        Z["w6"] --> AA["w7"]
    end

4.7 FPU Registers

Table 4-7. FPU Status Register (FSR)

313029282726252423222120191817161514131211109876543210
rdreserved(00)temnsreserved(00)verfttqnereserved (0)fccaexccexc
nvmofmufmdzmnxmnvaofaufadzanxanvcofcufcdzcnxc
r/wrr/wrrrr/wrrr/wr/wr/w
x00x000100x0x

■ rd – Rounding Direction

  • rd field defines the rounding direction used by the TSC695F FPU during a floating-point arithmetic operation.
  • 0 = round to nearest (tie-even)
  • 1 = round to zero
  • 2 = round to +infinity
  • 3 = round to -infinity

Microchip TSC695F - FPU Registers - 1

text_image -∞ Value < 0 0 Value > 0 +∞ round to -∞ round to +∞ round to -∞ round to zero round to +∞

- tem field enables traps caused by FPops. These bits are ANDed with the bits of the cexc (current exception field) to determine whether to force a floating-point exception to IU. All trap enable fields correspond to the similarly named bit in the cexc field.

  • 0 = trap disabled
  • 1 = trap enabled

■ nvm – invalid Operation Trap Mask
■ ofm – Overflow Trap Mask
■ ufm – Underflow Trap Mask
■ dzm – Division-by-zero Trap Mask
- nxm – iNexact Trap Mask
■ ns – Non Standard floating-point

- IEEE mode, bit always set to 0

■ ver – FPU Version

- The current version number for the TSC695F FPU is 100_b .

■ ftt – Floating-point Trap Type

  • ftt field identifies the floating-point trap type of the current floating-point exception.
  • 0 (000 b) = none
  • 1 (001 b) = IEEE exception
  • => invalid operation
  • => overflow -

- => underflow

- => division-by-zero

- => inexact

- 2 (010 b) = unfinished FPop

- Operations on normalized floating-point numbers either encounter a denormalized operand or produce a denormalized result.

- 3 ( 0_b ) =1unimplemented FPop

- This exception is asserted upon encountering a defined SPARC FPop instruction that is not supported by the TSC695F. This includes all operations using extended-precision format operands.

- 4 (100 b) = sequence error

- This exception is asserted when a floating-point instruction (other than FP store) is attempted after the FPU has entered either pending exception or exception mode. The TSC695F suspends all instruction execution with the exception of FP stores until the FP exception has been acknowledged and the FP queue has been cleared

- 5 (101 b) = data bus error

- Parity error on internal data bus.

- 6 (1_b)=0restartable error

- ? Parity error on address and control internal buses.

-7 (111 b) = non-restartable error

- Parity error on FPU registers.

■ qne – Queue Not Empty

- qne bit signals whether the FP queue is empty.

- 0 = queue empty

- 1 = queue not empty

■ fcc – Floating-point Condition Code

- fcc field reports the FP condition codes.

- 0 ( 0) θ ==

- 1 ( Q) ≠ <

- 2 (1) θ >

- 3 (1) ≠ ? (unordered)

■ aexc – Accumulated Exception

- aexc field reports the accumulated FP exceptions that are masked by the tem field. All masked exception cases are ORed with the contents of the aexc and accumulated as status. All accumulated fields have the same definition as the corresponding field for cexc.

- nva - iNValid Operation Accumulated Exception

- ofa - Overflow Accumulated Exception

- ufa - UnderFlow Accumulated Exception

- dza - Division-by-zero Accumulated Exception

- nxa - iNexact Accumulated Exception

■ cexc – Current Exception

  • cexc field reports the current FP exceptions. This field is automatically cleared upon the execution of the next floating-point instruction. cexc status is not lost upon assertion of a floating-point exception, because instructions following a valid exception are not executed by the TSC695F FPU.
  • nvc - iNValid Operation Current Exception
  • This is defined as an operation using an improper operand value.
  • ofc - Overflow Current Exception
  • The rounded result would be larger in magnitude than the largest normalized number in the specified format.
  • ufc - UnderFlow Current Exception
  • The rounded result is inexact, and would be smaller in magnitude than the smallest normalized number in the indicated format.
  • dzc - Division-by-zero Current Exception
  • X/0, where X is subnormal or normalized. Note that 0/0 does not set the dzc bit.
  • nxc - iNeXact Current Exception
  • The rounded result differs from the infinitely precise correct result.

4.8 FPU Queue Registers

Table 4-8. FPU Queue Registers (FQ)

313029282726252423222120191817161514131211109876543210
fpop address
r
x
fpop instruction
r
x

The FPU maintains a floating-point queue of the instruction that has started execution, but has yet to complete execution. The FP queue is used to accommodate the multiple clock nature of floating-point instructions and to support the handling of FP exceptions.

When the FPU encounters an exception case, it asserts a floating-point exception and enters pending exception mode. The FPU remains in pending exception mode until the FPU encounters another floating-point instruction, then the FPU enters exception mode. In exception mode, floating-point execution halts until the FP queue is emptied. This allows the FPU to store the floating-point instructions under execution when the exception case occurred. Emptying the FP queue frees the FPU for use by the trap handler without losing the pre-exception state.

The FP queue contains the 32-bit address and 32-bit FPop instruction of one instruction under execution. Floating-point load and store instructions and FP branch instructions are not queued. The entry of the FP queue is accessible by executing the store double

floating-point queue (STDFQ) instruction. A load FP queue instruction does not exist, as the FP queue must be loaded by launching instructions.

4.9 FPU f Registers

Table 4-9. FPU f Registers

313029282726252423222120191817161514131211109876543210
f 0
f 1
...
...
f 30
f 31
r/w
x

The FPU provides 32 registers for floating-point operations, referred to as f registers. These registers are 32 bits in length, which can be concatenated to support 64-bit double words. Extended precision instructions are not supported in the TSC695F FPU.

Integer and single precision data requires a single 32-bit f register. Double precision data requires 64 bits of storage and occupies an even-odd pair of adjacent f registers.

4.10 System

Registers

4.10.1 System

Management

Registers

Table 4-10. System Control Register (SYSCTR)

address = 0x 01f8 0000 Supervisor and User Read Supervisor Write
313029282726252423222120191817161514131211109876543210
usucsusbupupeubrdstdpedmaeiwderhsyshesyshemskreserved(0000)rhiuheiuhemskrhiuemiuemmskwdcsbpbtoswrprd
r/w r r/w rr/w
0000 000110110101x000000000010100

4-60 TSC695F User Manual

Microchip TSC695F - System - 1

■ us – UARTs Scaler

- us field fixes the division of both UARTs input clock.

- 0 = UARTs stopped

$$ - 1 \text { up to } 2 5 5 = \quad u s = \frac {\text { Clock }}{3 2 \cdot \text { BaudRate } (2 - u b r)} - 1 $$

■ ucs – UARTs Clock Supply

- ucs bit enables which clock is used to drive both UARTs.

- 0 = UARTs clock ← external watchdog clock (WDCLK)

- 1 = UARTs clock system clock (SYSCLK) (default)

■ usb – UARTs Stop Bit

- usb bit enables the generation/checking of the stop bit slot(s) on serial link messages for both UARTs.

-0 = 1 stop bit

- 1 = 2 stop bits

■ up – UARTs Parity

- up bit enables odd or even parity on serial link messages for both UARTs if upe bit is set.

- 0 = even parity

- 1 = odd parity (default)

■ upe – UARTs Parity Enable

- upe bit enables parity on serial link messages for both UARTs.

- 0 = serial link parity disabled

- 1 = serial link parity enabled (default)

■ ubr – UARTs Baud Rate

- ubr bit adds an 1-bit prescaler in front of the input clock for both UARTs.

- 0 = UARTs clock system clock (SYSCLK) or external clock (WDCLK) with prescaler (divide by 2)

- 1 = UARTs clock system clock (SYSCLK) or external clock (WDCLK), no prescaler

■ dst – DMA Session Timeout

- dst bit enables a DMA session timeout function preventing the DMA unit to lockout the processor by asserting DMAREQ for more than 1024 system clock cycles after the assertion of DMAGNT. Then, a memory exception is asserted and the DMAGNT is removed.

- 0 = DMA session timeout disabled

- 1 = DMA session timeout enabled (default)

■ dpe – DMA Parity Enable

- dpe bit enables parity checking during DMA write accesses.

- 0 = DMA parity disabled

- 1 = DMA parity enabled

■ dmae – DMA Enable

  • dmae bit enables DMA accesses.
  • 0 = DMA access disabled
  • 1 = DMA access enabled (default)

■ iwde – Internal Watchdog Enable

  • iwde bit is the direct image of IWDE pin.
  • 0 = IWDE pin low, EWDINT pin used.
  • 1 = IWDE pin high, internal Watchdog active

- rhsyshe – Reset or Halt when System Hardware Error

  • rhsyshe bit enables a reset or an halt action when the system detects an 'hardware error' enabled by syshemsk bit.
  • 0 = halt action in case of system 'hardware error'
  • 1 = reset action in case of system 'hardware error'

■ syshemsk – System Hardware Error Mask

  • syshemsk bit masks the internal information which is asserted when the system detects an 'hardware error'.
  • 0 = error not masked (default)
  • 1 = error masked (≡ disabled)

■ rhiuhe – Reset or Halt when IU Hardware Error

  • rhiuhe bit enables a reset or an halt action when the IU detects an 'hardware error' enabled by iuhemsk bit.
  • 0 = halt action in case of IU 'hardware error'
  • 1 = reset action in case of IU 'hardware error'

■ iuhemsk – IU Hardware Error Mask

  • iuhemsk bit masks the internal information which is asserted when the IU detects an 'hardware error'.
  • 0 = error not masked (default)
  • 1 = error masked (≡ disabled)

■ rhiuem – Reset or Halt when IU Error Mode

  • rhiuem bit enables a reset or an halt action when the IU enters the 'error mode' state enabled by iuemmsk bit.
  • 0 = halt action in case of IU 'error mode'
  • 1 = reset action in case of IU 'error mode'

■ iuemmsk – IU Error Mode Mask

  • iuemmsk bit masks the internal information which is asserted when the IU enters the 'error mode' state.
  • 0 = error not masked (default)
  • 1 = error masked (≡ disabled)

■ wdc s – Watchdog Clock Supply

- wdc s bit adds a 4-bit prescaler in front of the input clock for the internal watchdog timer.

  • 0 = watchdog clock ← external clock (WDCLK), no prescaler
  • 1 = watchdog clock ← external clock (WDCLK) with prescaler (divide by 16)

■ bp – Block Protection

  • bp bit defines the write access protection type which is segment based. The bp bit inverts the address criterion for the protection function.
  • 0 = write access allowed within segments and not outside (segment mode)
  • 1 = write access allowed outside segments and not within (block mode)

■ bto – Bus Timeout

- bto bit enables (or no) the bus timeout function. A bus timeout function of 256 or 1024 SYSCLK cycles is provided for the bus ready controlled memory areas, 256 in the Extended RAM, Extended General and Extended I/O areas and 1024 in the Extended PROM area.

  • 0 = bus timeout function disabled
  • 1 = bus timeout function enabled (default)

■ swr – Software Reset

  • swr bit allows (or no) the software reset command, the writing to SWRST register.
  • 0 = software reset not allowed
  • 1 = software reset allowed

■ prd – Power-down

  • prd bit allows (or no) the power down command, the writing to PDOWN register.
  • 0 = power down not allowed
  • 1 = power down allowed

Table 4-11. Software Reset (SWRST)

address = 0x 01f8 0004 Supervisor Write
313029282726252423222120191817161514131211109876543210
...
w
x

Write only with any data. A write to this register will cause the system to issue the RESET signal if the software reset function is enabled in the System Control register (swr bit). If the software reset function is not enabled, a write to this register will have no effect.

Table 4-12. Power-down (PDOWN)

address = 0x 01f8 0008 Supervisor Write
313029282726252423222120191817161514131211109876543210
...
w
x

Write only with any data. A write to this register will cause the system to enter power down mode if the power down function is enabled in the System Control Register (prd bit). If the power down function is not enabled, a write to this register will have no effect.

Table 4-13. System Fault Status Register (SYSFSR)

address = 0x 01f8 00a0 Supervisor and User Read Supervisor Write
313029282726252423222120191817161514131211109876543210
reserved (0000 0000 0000 0000) atreserved (0)asftasfvreserved (0)srftsrfvreserved (00)
rrr/wr/w/r/wr
0000 0000 0000 00000000000001111000

The register is reset by writing any value to it. The SYSFSR reset value is 0x00000078.

■ at – Access Type

- Accesses in the 'Extended General' area are treated as RAM accesses from an access type point of view.

AtAccess TypeAccess ModeASI[3:0]
0000LoadUser data RAM/ROM/System Registers 0xa(1010b)
0001LoadSupervisor data RAM/ROM/System Registers0xb (1011b)
(0010) /Not used
(0011) /Not used
0100LoadDMA RAM/ROM/System RegistersDo not care
0101Load/Execute User I/O/Exchange0xa (1010b),0x8 (1000b)
0110Load/Execute Supervisor I/O/Exchange0xb (1011b),0x9 (1001b)
0111LoadDMA I/O/ExchangeDo not care
1000StoreUser data RAM/ROM/System Registers 0xa(1010b)
1001StoreSupervisor data RAM/ROM/System Registers0xb (1011b)
(1010) / Not used
(1011) / Not used
1100 StoreDMA RAM/ROM/System Registers Do not care
1101Store User I/O/Exchange 0xa (1010_b), 0x8 (1000_b)
1110Store Supervisor I/O/Exchange 0xb (1011_b), 0x9 (1001_b)
1111StoreDMA I/O/ExchangeDo not care

■ asft – Asynchronous Fault Type

- asft field gives information about some asynchronous faults. This information can be extracted by software from Interrupt Pending Register as well.

ASFTFault Type
00Watchdog timeout (FAILAR not updated)
01DMA timeout (FAILAR not updated) or access error (FAILAR updated)
10UART error (FAILAR not updated)
11memory correctable error (FAILAR updated)

■ asfv – Asynchronous Fault Valid

  • asfv bit indicates that the asft field is valid, an asynchronous fault has occurred.
    -0 = not valid
  • 1 = valid

This bit must be reset by software during trap handling to enable further SYSFSR and FAILAR updates on asynchronous fault detection

■ srft – Synchronous Fault Type

- srft field gives information about some synchronous faults.

srftFault Type
0000parity error on control bus
0001parity error on data bus
0010parity error on address bus
0011access to protected area
0100access to unimplemented area
0101system registers parity error
0110system registers access violation
srftFault Type
1000bus timeout
1001bus error
1010(not used)
1011(not used)
1100(not used)
1101(not used)
1110(not used)
srft Fault Type
0111 uncorrectable error in memory 1111 reset value
srft Fault Type

■ srfv – Synchronous Fault Valid

- srfv bit indicates that the srft field is valid, a synchronous fault has occurred. DMA error cannot overwrite the SYSFSR and FAILAR if srfv bit is set.

$$ \begin{array}{l} - 0 = \text { not valid } \ - 1 = \text { v a l i d } \ \end{array} $$

This bit must be reset by software during trap handling to enable further SYSFSR and FAILAR updates on asynchronous fault detection and DMA synchronous errors.

Figure 4-2. FAILAR and SYSFSR Update Diagram
Microchip TSC695F - ■ srfv – Synchronous Fault Valid - 1

flowchart
graph TD
    A["Asynchronous fault occurrence"] --> B{asfv = 0 ?}
    B -->|n| C{srfv = 0 ?}
    C -->|y| D["asft updated asfv = 1 FAILAR updated"]
    E["Synchronous fault occurrence"] --> F{srfv = 0 ?}
    F -->|n| G{asfv = 0 ?}
    G -->|y| H["asft updated srfv = 1 FAILAR updated"]
    D --> I["trap generation"]
    H --> I
    C --> J["asfv = 0"]
    G --> K["asft updated asfv = 1 FAILAR updated"]

Notes: 1. After a trap occurrence, it is the responsibility of the software trap handler to reset or not SYSFSR by writing any value to it. 2. This diagram is applicable only to the faults that update the SYSFSR (refer to "Trap" section).

Table 4-14. Failing Address Register (FAILAR)

address = 0x 01f8 00a4 Supervisor Read
313029282726252423222120191817161514131211109876543210
fa
r
0000 0000 0000 0000 0000 0000 0000 0000

■ fa – Failing Address

- fa field contents the failing address of a synchronous or asynchronous fault which has occurred.

Table 4-15. Error and Reset Status Register (ERRRSR)

address = 0x 01f8 00b0 Supervisor and User Read Supervisor Write
313029282726252423222120191817161514131211109876543210
reserved (0000 0000 0000 0000)rstchltsysavreserved(00 0000)syshereserved (0)fpuhereserved (0)iuheiuem
rrrr/wrr/wrr/wrr/w
0000 0000 0000 0000x0000 00000000000

■ rstc – Reset Cause

  • rstc field indicates what type of reset has occurred.
  • 00 = system reset (or OCD)
    -01 = software reset
  • 10 = error reset
  • 11 = watchdog reset

■ hlt-Halt

  • h/t bit indicates that the IU and FPU is halted.
  • 0 = not active
  • 1 = a c t i v e

■ sysav – System Availability

- sysav bit can be used by software to indicate system availability. sysav bit is cleared by reset and is programmable by software. Note that SYSAV output will be asserted only if sysav bit is set and SYSERR is deasserted, i.e., no error has been detected.

- 0 = not active

- 1 = a c t i v e

■ syshe – System Hardware Error

  • syshe bit indicates hardware error on system registers. syshe bit is only writable when ewe bit in the Test Control Register (TESCTR) is set.
  • 0 = no error
  • 1 = internal parity error

■ fpuhe – FPU Hardware Error

  • fpuhe bit indicates hardware error on FPU. fpuhe bit is only writable when ewe bit in the Test Control Register (TESCTR) is set.
    -0 = no error
  • 1 = internal parity error

■ iuhe – IU Hardware Error

  • iuhe bit indicates hardware error on IU. iuhe bit is only writable when ewe bit in the Test Control Register (TESCTR) is set.
    -0 = no error
  • 1 = internal parity error

■ iuem – IU Error Mode

- iuem bit indicates that the IU is in error mode. iuem bit is only writable when ewe bit in the Test Control Register (TESCTR) is set.

- 0 = no error

- 1 = error

Table 4-16. Test Control Register (TESCTR)

address = 0x 01f8 00d0 Supervisor and User Read Supervisor Write
313029282726252423222120191817161514131211109876543210
reserved (000 0000 0000)ewe=p#reserved (00 0000 0000) cb
rr/wr/wr/wr/wr/w
000 0000 00000 00 000 00000000000 0000

■ ewe – Error Write Enable

  • By enabling ewe bit, an error could be simulated by writing syshe, fpuhe, iuhe or/and iuem bits in the Error and Reset Status Register (ERRRSR).
  • 0 = writing disable
  • 1 = writing enable

■ it – Interrupt Force Enable

  • it bit enables the using of the Interrupt Force Register (INTFCR).
  • 0 = interrupt force disable
  • 1 = interrupt force enable

■ pt – Parity Test Mode

  • pt bit allows fault injection for parity test purposes. By enabling parity test mode, wrong parity will be generated when any System Register is read.
  • 0 = test mode disabled
  • 1 = test mode enabled
  • et bit allows fault injection for memory test purposes and also test of the EDAC function itself. By enabling EDAC test mode, the bits in the cb field of this Register will substitute the normal checkbits during following store cycles.
  • 0 = test mode disabled
  • 1 = test mode enabled

■ cb – Checks Bits for Test Mode

- cb field allows fault injection for memory and EDAC test purposes if et bit is set.

4.11 Configuration Registers

Table 4-17. Memory Configuration Register (MCNFR)

address = 0x 01f8 0010 Supervisor and User Read Supervisor Write
313029282726252423222120191817161514131211109876543210
reserved(00)eexeecepaesizreserved(000)psizp8pwrreserved(0)recrparsizrbr1rbs1rbr0rbs0rbcs
rr/wr/wrr/wrr/wrr/wr/wr/wr/wr/w
00000000000000x10000000000000000

■ eex – Enable Exchange Memory

  • eex bit enables the Exchange Memory space (from at 0x 01f0 0000).
  • 0 = disable exchange memory space
  • 1 = enable exchange memory space

■ eec – Exchange Memory EDAC Protected

  • eec bit enables an EDAC protection on the Exchange Memory space. If eec is set, automatically a parity protection is done regardless the epa bit value.
  • 0 = EDAC protection disabled
  • 1 = EDAC protection enabled

■ epa – Exchange Memory Parity Protected

- epa bit only enables an parity protection on the Exchange Memory space. If eec is set, the epa bit value is don't care. If NOPAR (NOPAR*) pin is tied to ground, setting epa bit has no effect.

  • 0 = parity protection disabled
  • 1 = parity protection enabled

■ esiz – Exchange Memory Size

- esiz field fixes the Exchange Memory size in the Exchange Memory space.

esizSize
0004 Kbytes
0018 Kbytes
01016 Kbytes
01132 Kbytes
esizSize
10064 Kbytes
101128 Kbytes
110256 Kbytes
111512 Kbytes

■ psiz – Boot PROM Size

- psiz field fixes the PROM size in the Boot PROM space.

psiz Size psiz Size
000 128 Kbytes 100 2 Mbytes
001 256 Kbytes 101 4 Mbytes
010 512 Kbytes 110 8 Mbytes
011 1 Mbyte 111 16 Mbytes

■ p8 – PROM 8-bit wide

  • p8 bit is, at reset, written with the same value as 8 (PROM8*) input pin. A write operation to this bit has no effect (is don't care).
  • 0 = 8-bit wide, parity generated internally
  • 1 = 40-bit wide, EDAC and parity

■ pwr – PROM Write Function

  • pwr bit only enables the state of (ROMWRT*) input pin.
  • 0 = function disabled
  • 1 = function enabled if external ROMWRT present

■ rec – RAM EDAC Protected

  • rec bit enables an EDAC protection on the RAM and Extended RAM spaces. If rec is set, automatically a parity protection is done regardless the rpa bit value.
  • 0 = EDAC protection disabled
  • 1 = EDAC protection enabled

■ rpa – RAM Parity Protected

  • rpa bit only enables an parity protection on the RAM and Extended RAM spaces. If rec is set, the rpa bit value is don't care. If NOPAR (NOPAR*) pin is tied to ground, setting rpa bit has no effect.
  • 0 = parity protection disabled
  • 1 = parity protection enabled

■ rsiz – RAM Size

- rsiz field fixes the RAM size only in the RAM space regardless the number of banks.

rsiz Size
000 256 Kbytes100 4 Mbytes
001 512 Kbytes101 8 Mbytes
010 1 Mbytes
011 2 Mbyte111 32 Mbytes
rsiz Size
110 16 Mbytes

■ rbr1 – Redundant RAM Block-1 Replace

- rbr1 field fixes the replacement of any RAM block by the RAM block-1. The MEMCS[x] (MEMCS[x])* signal corresponding to the replaced block will be

inactive and MEMCS[9] signal will be active instead. If rbr0 and rbr1 are set to the same value, rbr1 setting will have no effect.

rbr1 Function rbr1 Function
000 MEMCS [0] inactive and replaced 100 MEMCS[4]
001 MEMCS [1] inactive and replaced 101 MEMCS[5]
010 MEMCS [2] inactive and replaced 110 MEMCS[6]
011 MEMCS [3] inactive and replaced 111 MEMCS[7]

■ rbs1 – Redundant RAM Block-1 Selected

  • rbs1 bit selects the replacement of any RAM block by the RAM block-1 (see rbr1 field description).
  • 0 = block-1 not selected
  • 1 = block-1 selected

■ rbr0 – Redundant RAM Block-0 Replace

- rbr0 field fixes the replacement of any RAM block by the RAM block-0. The MEMCS[x] (MEMCS[x])* signal corresponding to the replaced block will be inactive and MEMCS[8] signal will be active instead. If rbr0 and rbr1 are set to the same value, rbr1 setting will have no effect.

rbr0 Function rbr0 Function
000 MEMCS [0] inactive and replaced 100 MEMCS[4]
001 MEMCS [1] inactive and replaced 101 MEMCS[5]
010 MEMCS [2] inactive and replaced 110 MEMCS[6]
011 MEMCS [3] inactive and replaced 111 MEMCS[7]

■ rbs0 – Redundant RAM Block-0 Selected

  • rbs0 bit selects the replacement of any RAM block by the RAM block-0 (see rbr0 field description).
  • 0 = block-0 not selected
  • 1 = block-0 selected

■ rbcs – Number of RAM Block Chip Selects

- rbcs field enables the number of RAM block chip selects. The selected RAM size (rsiz field) must be divided into 1, 2, 4 or 8 equally sized RAM blocks.

rbcsFunction
00 [0] active
01 [1,0] active
rbcs Function
10 [3..0] active
11 [7..0] active

Table 4-18. I/O Configuration Register (IOCNFR)

address = 0x 01f8 0014 Supervisor and User Read Supervisor Write
313029282726252423222120191817161514131211109876543210
reserved(00)pa3io3siz3reserved(00)pa2io2siz2reserved(00)pa1io1siz1reserved(00)pa0io0siz0
rr/wrr/wr
00000000000000000000000

■ pa3 – I/O Area 3 Parity Protected

  • pa3 bit only enables an parity protection on the I/O Area 3 space. If NOPAR (NOPAR*) pin is tied to ground, setting pa3 bit has no effect.
  • 0 = parity protection disabled
  • 1 = parity protection enabled, TSC695F checks parity

■ io3 – I/O Area 3 Enable

  • io3 bit enables the I/O Area 3 space (from at 0x 1300 0000).
    -0 = disable
  • 1 = enable

■ siz3 – I/O Area 3 Size

- siz3 field fixes the size in the I/O Area 3 space.

siz3Size
0000512 bytes
00011 Kbytes
00102 Kbytes
00114 Kbytes
siz3Size
01008 Kbytes
010116 Kbytes
011032 Kbytes
011164 Kbytes
siz3Size
1000128 Kbytes
1001256 Kbytes
1010512 Kbytes
10111 Mbytes
siz3Size
11002 Mbytes
11014 Mbytes
11108 Mbytes
111116 Mbytes

■ pa2 – I/O Area 2 Parity Protected

  • pa2 bit only enables an parity protection on the I/O Area 2 space. If NOPAR (NOPAR*) pin is tied to ground, setting pa2 bit has no effect.
  • 0 = parity protection disabled
  • 1 = parity protection enabled, TSC695F checks parity

■ io2 - I/O Area 2 Enable

  • io2 bit enables the I/O Area 2 space (from at 0x 1200 0000).
    -0 = disable
  • 1 = enable

■ siz2 – I/O Area 2 Size

- siz2 field fixes the size in the I/O Area 2 space.

siz2 Size siz2 Sizesiz2 Sizesiz2 Size
0000 512 bytes 0100 8Kbytes1000 128 Kbytes1100 2Mbytes
0001 1Kbytes 0101 16Kbytes1001 256 Kbytes1101 4Mbytes
0010 2Kbytes 0110 32Kbytes1010 512 Kbytes1110 8 Mbytes
00114 Kbytes011164 Kbytes10111 Mbytes111116 Mbytes

■ pa1 – I/O Area 1 Parity Protected

  • pa1 bit only enables an parity protection on the I/O Area 1 space. If NOPAR (NOPAR*) pin is tied to ground, setting pa1 bit has no effect.
  • 0 = parity protection disabled
  • 1 = parity protection enabled, TSC695F checks parity

■ io1 - I/O Area 1 Enable

  • io1 bit enables the I/O Area 1 space (from at 0x 1100 0000).
  • 0 = disable
  • 1 = enable

■ siz1 – I/O Area 1 Size

- siz1 field fixes the size in the I/O Area 1 space.

siz1 Size siz1 Sizesiz1 Size siz1 Size
0000 512 bytes 0100 8Kbytes1000 128 Kbytes1100 2Mbytes
0001 1Kbytes 0101 16Kbytes1001 256 Kbytes1101 4Mbytes
0010 2Kbytes 0110 32Kbytes1010 512 Kbytes1110 8 Mbytes
00114 Kbytes011164 Kbytes10111 Mbytes111116 Mbytes

■ pa0 – I/O Area 0 Parity Protected

  • pa0 bit only enables an parity protection on the I/O Area 0 space. If NOPAR (NOPAR*) pin is tied to ground, setting pa0 bit has no effect.
  • 0 = parity protection disabled
  • 1 = parity protection enabled, TSC695F checks parity

■ io0 - I/O Area 0 Enable

  • io0 bit enables the I/O Area 0 space (from at 0x 1000 0000).
    -0 = disable
  • 1 = enable

■ siz0 - I/O Area 0 Size

- siz0 field fixes the size in the I/O Area 0 space.

siz0 Size siz0 Sizesiz0 Sizesiz0 Size
0000 512 bytes 0100 8Kbytes1000 128 Kbytes1100 2Mbytes
0001 1Kbytes 0101 16Kbytes1001 256 Kbytes1101 4Mbytes
siz0 Sizesiz0 Sizesiz0 Sizesiz0 Size
0010 2Kbytes 0110 32Kbytes1010 512 Kbytes1110 8Mbytes
0011 4Kbytes 0111 64Kbytes 10111 Mbytes 111116 Mbytes

Table 4-19. Waitstate Configuration Register (WSCNFR)

address = 0x 01f8 0018 Supervisor and User Read Supervisor Write
313029282726252423222120191817161514131211109876543210
io3rwio2rwio1rwio0rwexrwprwprrrawrar
r/wr/wr/wr/wr/wr/wr/wr/wr/w
11111111111111111111111111111111

■ io3rw – I/O Area 3, nbr of Read/Write Waitstates

- io3rw field fixes the number of waitstates in the I/O Area 3 space. The TSC695F always inserts a minimum of 1 waitstate to wait for BUSRDY (BUSRDY*) signal, even 0 waitstate is programmed.

io3rwWaitstateRead or Write Cycle
00000 ws3 SYSCLK periods
00011 ws3 SYSCLK periods
xxxxn ws(2+n) SYSCLK periods
111115 ws17 SYSCLK periods

■ io2rw – I/O Area 2, nbr of Read/Write Waitstates

- io2rw field fixes the number of waitstates in the I/O Area 2 space. The TSC695F always inserts a minimum of 1 waitstate to wait for BUSRDY (BUSRDY*) signal, even 0 waitstates is programmed.

io2rwWaitstateRead or Write Cycle
00000 ws3 SYSCLK periods
00011 ws3 SYSCLK periods
xxxxn ws(2+n) SYSCLK periods
111115 ws17 SYSCLK periods

■ io1rw - I/O Area 1, nbr of Read/Write Waitstates

- io1rw field fixes the number of waitstates in the I/O Area 1 space. The TSC695F always inserts a minimum of 1 waitstate to wait for BUSRDY (BUSRDY*) signal, even 0 waitstates is programmed.

io1rw Waitstate Read or Write Cycle
0000 0 ws 3 SYSCLK periods
0001 1 ws 3 SYSCLK periods
xxxx n ws (2+n) SYSCLK periods
1111 15 ws 17 SYSCLK periods

■ io0rw – I/O Area 0, nbr of Read/Write Waitstates

- io0rw field fixes the number of waitstates in the I/O Area 0 space. The TSC695F inserts a minimum of 1 waitstate to wait for BUSRDY (BUSRDY*) signal.

io0rw Waitstate Read or Write Cycle
0000 0 3SYSCLK periods
0001 13 SYSCLK periods
xxxxn(2+n) SYSCLK periods
11111517 SYSCLK periods

■ exrw – EXchange Memory, nbr of Read/Write Waitstates

- exrw field fixes the number of waitstates in the Exchange Memory space. The TSC695F always inserts 2 waitstates to wait for BUSRDY (BUSRDY*) signal.

exrwWaitstateRead CycleWrite Cycle
00000 3 SYSCLK4 SYSCLK periodsK periods
000114 SYSCLK periods5 SYSCLK periods
xxxxn(3+n) SYSCLK periods(4+n) SYSCLK periods
11111518 SYSCLK periods19 SYSCLK periods

■ prw – PROM Boot, nbr of Write Waitstates

- prw field fixes the number of waitstates in the PROM Boot space during write cycles. The TSC695F always inserts a minimum of 1 waitstate to wait for BUSRDY (BUSRDY*) signal, even 0 ws is programmed.

  • PROM 8-bit configuration
prw Waitstate Write (Byte)Cycle
0000 0 3SYSCLK periods
0001 1 3SYSCLK periods
xxxxn(2+n)SYSCLK
11111517SYSCLK periods

Note: If PROM8 (PROM8*) is asserted (PROM Boot 8-bit), only 'store byte' is available.

  • PROM 40-bit configuration
prw Waitstate Write (Word)Cycle
0000 0 3SYSCLK periods
0001 1 3SYSCLK periods
xxxxn(2+n) SYSCLK periods
11111517 SYSCLK periods

Note: If PROM8 (PROM8*) is deasserted (PROM Boot 40-bit), only 'store word' or 'store double-word' is available.

■ prr – PROM Boot, nbr of Read Waitstates

  • prr field fixes the number of waitstates in PROM Boot space during read cycles. The TSC695F always inserts a minimum of 1 waitstate to wait for BUSRDY (BUSRDY*) signal, even 0 ws is programmed.
  • PROM 8-bit configuration
prrWaitstate Read cycle
0000 0 6SYSCLK periods
0001 1 6SYSCLK periods
xxxx n (2 + 4*n) SYSCLK periods
11111562 SYSCLK periods

Note: If PROM8 (PROM8*) is asserted (PROM Boot 8-bit), always a load access (byte, half-word or word) or a fetch to PROM Boot will be performed in 4 byte fetches (to create 1 word).

  • PROM 40-bit configuration
prrWaitstate Read Cycle
0000 0 2SYSCLK periods
prrWaitstateRead Cycle
0001 1 2SYSCLK periods
xxxxn(1+n) SYSCLK
11111516 SYSCLK periods

Note: If PROM8 (PROM8*) is deasserted (PROM Boot 40-bit), always a load access (byte, half-word or word) or a fetch to PROM Boot will be performed in 1 word fetch.

■ raw – RAM, nbr of Write Waitstates

- raw field fixes the number of waitstates in RAM space.

rawWaitstateWrite Cycle
000 2 SYSCLK periods
011 3 SYSCLK periods
112 4 SYSCLK periods
1135 SYSCLK periods

Notes: 1. Always a byte or half-word store access to RAM will be performed in 1 word fetch + byte or half-word modification (into TSC695F) + 1 word store.
2. Raw must be greater or equal than rar.

■ rar – RAM, nbr of Read Waitstates

- raw field fixes the number of waitstates in RAM space.

rarWaitstateRead Cycle
000 1 SYSCLK periods
011 2 SYSCLK periods
112 3 SYSCLK periods
1134 SYSCLK periods

Notes: 1. Always a load access (byte, half-word or word) or a fetch to RAM will be performed in 1 word access.
2. Raw must be greater or equal than rar.

4.12 Access

Protection

Registers

Table 4-20. Access Protection Segment 1 Base Register (APS1BR)

address = 0x 01f8 0020 Supervisor and User Read Supervisor Write
313029282726252423222120191817161514131211109876543210
reserved (000 0000) _s _w seg1base
rr/wr/wr/w

Table 4-20. Access Protection Segment 1 Base Register (APS1BR)

address = 0x 01f8 0020 Supervisor and User Read Supervisor Write
313029282726252423222120191817161514131211109876543210
000 0000 0 0 000 00000000 0000 0000 0000

■ se1 – Supervisor Enable – Segment 1

  • se1 bit enables the write protection in supervisor mode on the segment 1 defined by seg1base and seg1end.
  • 0 = write access protection disabled in supervisor mode
  • 1 = write access protection enabled in supervisor mode

■ ue1 – User Enable – Segment 1

  • se1 bit enables the write protection in user mode on the segment 1 defined by seg1base and seg1end.
  • 0 = write access protection disabled in user mode
  • 1 = write access protection enabled in user mode

■ seg1base – Segment 1 – BASE Address

  • seg1base field defines the base address for the segment 1. The 'Segment 1 - Base Address' is calculated according to the formula:
  • Segment 1 - Base Address = 0x02000000 + (seg1base * 4)

Table 4-21. Access Protection Segment 1 End Register (APS1ER)

address = 0x 01f8 0024 Supervisor and User Read Supervisor Write
313029282726252423222120191817161514131211109876543210
reserved (0 0000 0000)seg1end
rr/w
0 0000 0000000 0000 0000 0000 0000 0000

■ seg1end – Segment 1 – END Address

  • seg1end field denotes the first address outside the segment 1. The 'Segment 1 – End Address' is calculated according to the formula:
  • Segment 1 - End Address = 0x02000000 + (seg1end * 4)

Table 4-22. Access Protection Segment 2 Base Register (APS2BR)

address = 0x 01f8 0028 Supervisor and User Read Supervisor Write
313029282726252423222120191817161514131211109876543210
reserved (000 0000)seg2seg2seg2base
rr/wr/wr/w
000 0000 0 0 000 00000000 0000 0000 0000

■ se2 – Supervisor Enable – Segment 2

4-78 TSC695F User Manual

Microchip TSC695F - Registers - 1

  • se2 bit enables the write protection in supervisor mode on the segment 2 defined by seg2base and seg2end.
  • 0 = write access protection disabled in supervisor mode
  • 1 = write access protection enabled in supervisor mode

■ ue2 – User Enable – Segment 2

  • se2 bit enables the write protection in user mode on the segment 2 defined by seg2base and seg2end.
  • 0 = write access protection disabled in user mode
  • 1 = write access protection enabled in user mode

■ seg2base – Segment 2 – BASE Address

  • seg2base field defines the base address for the segment 2. The 'Segment 2 - Base Address' is calculated according to the formula:
  • Segment 2 - Base Address = 0x02000000 + (seg2base * 4)

Table 4-23. Access Protection Segment 2 End Register (APS2ER)

address = 0x 01f8 002c Supervisor and User Read Supervisor Write
313029282726252423222120191817161514131211109876543210
reserved (0 0000 0000)segend
rr/w
0 0000 0000000 0000 0000 0000 0000 0000

■ seg2end – Segment 2 – END Address

  • seg2end field denotes the first address outside the segment 2. The 'Segment 2 – End Address' is calculated according to the formula:
  • Segment 2 - End Address = 0x02000000 + (seg2end * 4)

4.13 Interrupt

Registers

Table 4-24. Interrupt Shape Register (INTSHR)

address = 0x 01f8 0044 Supervisor and User Read Supervisor Write
313029282726252423222120191817161514131211109876543210
reserved (000 0000 0000 0000 0000)polackedge
rr/wr/wr/w
000 0000 0000 0000 00000 00000000 0000

■ pol – External interrupts Polarity

- edge field defines the external interrupts (EXINT[7:0]) to be either active low or high when 'level triggered' mode is programmed, or to be either active on falling edge or rising edge when 'edge triggered' mode is programmed.

polFunction
'level triggered' mode 'edge triggered' mode
x xxx0LEVELTriging edgelow level falling edge
x xxx1 highLEVELTriging edge
x xx0xLEVELTriging triggerlow level level triggered
x xx1x highred
x x0xxLEVELTriging edgelow level falling edge
x x1xx high
x 0xxxLEVELTriging triggerlow level level triggered
x 1xxx highred
0 xxxxLEVELTriging edgelow level falling edge
1 xxxx high

■ ack – Acknowledge on external interrupt

- ack field routes the IU interrupt acknowledge of the chosen external interrupt on the EXTINTACK pin.

ack Function ack Function
000 noaction 100 EXTINT[3] acknowledge
001 EXTINT[0] acknowledged
010 EXTINT[1] acknowledged
011EXTINT[2] acknowledged
101 EXTINT[4] acknowledged
110 no action
111no action

■ edge – External interrupts EDGE (or level) triggered

- edge field defines the external interrupts (EXINT[7:0]) to be either active on edge or levels sensitive.

edgeFunction
x xxx0EXTINT[0]level triggered
x xxx1edge triggered x 1x
x xx0xEXTINT[1]level triggered
x xx1xedge triggered 1 xx
x x0xxEXTINT[2]level triggered
x x1xxedge triggered
edgeFunction
x 0xxxEXTINT edge triggerlevel triggered
triggered
0 xxxxEXTINT edge triggerlevel triggered
triggered

Table 4-25. Interrupt Pending Register (INTPDR)

address = 0x 01f8 0048 Supervisor and User Read
313029282726252423222120191817161514131211109876543210
reserved (0000 0000 0000 0000)WD timeoutEXTINT4RTCTGPTEXTINT3EXTINT2DMA timeoutDMA access errorUART errorcorr. err. in mem.UART BUART AEXTINT1EXTINT0msk.HW errorsreserved (0)
ip
rrr
0000 0000 0000 0000000 0000 0000 00000

■ ip[15] – Interrupt Pending on asynchronous INT 15

  • ip[15] bit reflects a pending interrupt on the internal or external Watchdog timeout. This interrupt is associated to the trap type (tt) 0x1F.
  • 0 = interrupt not pending
  • 1 = interrupt pending

■ ip[14] – Interrupt Pending on asynchronous INT 14

  • ip[14] bit reflects a pending interrupt on the external interrupt number 4 (EXTINT[4] pin). This interrupt is associated to the trap type (tt) 0x1E.
  • 0 = interrupt not pending
  • 1 = interrupt pending

■ ip[13] – Interrupt Pending on asynchronous INT 13

  • ip[13] bit reflects a pending interrupt on the Real-time Clock Timer. This interrupt is associated to the trap type (tt) 0x1D.
  • 0 = interrupt not pending
  • 1 = interrupt pending

■ ip[12] – Interrupt Pending on asynchronous INT 12

  • ip[12] bit reflects a pending interrupt on the General-purpose Timer. This interrupt is associated to the trap type (tt) 0x1C.
  • 0 = interrupt not pending
  • 1 = interrupt pending

■ ip[11] – Interrupt Pending on asynchronous INT 11

  • ip[11] bit reflects a pending interrupt on the external interrupt number 3 (EXTINT[3] pin). This interrupt is associated to the trap type (tt) 0x1B.
  • 0 = interrupt not pending
  • 1 = interrupt pending

■ ip[10] – Interrupt Pending on asynchronous INT 10

- ip[10] bit reflects a pending interrupt on the external interrupt number 2 (EXTINT[2] pin). This interrupt is associated to the trap type (tt) 0x1A.

- 0 = interrupt not pending
- 1 = interrupt pending 

■ ip[9] – Interrupt Pending on asynchronous INT 9

- ip[9] bit reflects a pending interrupt on a DMA timeout. This interrupt is associated to the trap type (tt) 0x19.
- 0 = interrupt not pending
- 1 = interrupt pending 

■ ip[8] – Interrupt Pending on asynchronous INT 8

- ip[8] bit reflects a pending interrupt on a DMA access error. This interrupt is associated to the trap type (tt) 0x18.
- 0 = interrupt not pending
- 1 = interrupt pending 

■ ip[7] – Interrupt Pending on asynchronous INT 7

- ip[7] bit reflects a pending interrupt on a UART error. This interrupt is associated to the trap type (tt) 0x17.
- 0 = interrupt not pending
- 1 = interrupt pending 

■ ip[6] – Interrupt Pending on asynchronous INT 6

- ip[6] bit reflects a pending interrupt on a correctable error in memory. This interrupt is associated to the trap type (tt) 0x16.
- 0 = interrupt not pending
- 1 = interrupt pending 

■ ip[5] – Interrupt Pending on asynchronous INT 5

- ip[5] bit reflects a pending interrupt on either UART 'B' data ready or transmitter ready. This interrupt is associated to the trap type (tt) 0x15.
- 0 = interrupt not pending
- 1 = interrupt pending 

■ ip[4] – Interrupt Pending on asynchronous INT 4

- ip[4] bit reflects a pending interrupt on either UART 'A' data ready or transmitter ready. This interrupt is associated to the trap type (tt) 0x14.
- 0 = interrupt not pending
- 1 = interrupt pending 

■ ip[3] – Interrupt Pending on asynchronous INT 3

- ip[3] bit reflects a pending interrupt on the external interrupt number 1 (EXTINT[1] pin). This interrupt is associated to the trap type (tt) 0x13.
- 0 = interrupt not pending
- 1 = interrupt pending 

■ ip[2] – Interrupt Pending on asynchronous INT 2

- ip[2] bit reflects a pending interrupt on the external interrupt number 0 (EXTINT[0] pin). This interrupt is associated to the trap type (tt) 0x12.
- 0 = interrupt not pending 

- 1 = interrupt pending

■ ip[1] – Interrupt Pending on asynchronous INT 1

  • ip[1] bit reflects a pending interrupt on masked hardware errors. This interrupt is associated to the trap type (tt) 0x11.
  • 0 = interrupt not pending
  • 1 = interrupt pending

Table 4-26. Interrupt Mask Register (INTMKR)

address = 0x 01f8 004c Supervisor and User Read Supervisor Write
313029282726252423222120191817161514131211109876543210
reserved (0 0000 0000 0000 0000)EXTINT4RTCTGPTEXTINT3EXTINT2DMA timeoutDMA access errorUART errorcorr. err. in mem.UART BUART AEXTINT1EXTINT0msk.HW errorsreserved (0)
im
rr
0 0000 0000 0000 000011 1111 1111 11110

■ im[14] – Interrupt Mask on asynchronous INT 14

  • im[14] bit masks the external interrupt number 4 (EXTINT[4] pin).
  • 0 = interrupt not masked
  • 1 = interrupt masked (default)

■ im[13] – Interrupt Mask on asynchronous INT 13

  • im[13] bit masks the interrupt on the Real-time Clock Timer.
  • 0 = interrupt not masked
  • 1 = interrupt masked (default)

■ im[12] – Interrupt Mask on asynchronous INT 12

  • im[12] bit masks the interrupt on the General-purpose Timer.
  • 0 = interrupt not masked
  • 1 = interrupt masked (default)

■ im[11] – Interrupt Mask on asynchronous INT 11

  • im[11] bit masks the external interrupt number 3 (EXTINT[3] pin).
  • 0 = interrupt not masked
  • 1 = interrupt masked (default)

■ im[10] – Interrupt Mask on asynchronous INT 10

  • im[10] bit masks the external interrupt number 2 (EXTINT[2] pin).
  • 0 = interrupt not masked
  • 1 = interrupt masked (default)

■ im[9] – Interrupt Mask on asynchronous INT 9

  • im[9] bit masks the interrupt on a DMA timeout.
  • 0 = interrupt not masked
  • 1 = interrupt masked (default)

■ im[8] – Interrupt Mask on asynchronous INT 8

  • im[8] bit masks the interrupt on a DMA access error.
  • 0 = interrupt not masked
  • 1 = interrupt masked (default)

■ im[7] – Interrupt Mask on asynchronous INT 7

  • im[7] bit masks the interrupt on a UART error.
  • 0 = interrupt not masked
  • 1 = interrupt masked (default)

■ im[6] – Interrupt Mask on asynchronous INT 6

  • im[6] bit masks the interrupt on a correctable error in memory.
  • 0 = interrupt not masked
  • 1 = interrupt masked (default)

■ im[5] – Interrupt Mask on asynchronous INT 5

  • im[5] bit masks the interrupt on either UART 'B' data ready or transmitter ready.
  • 0 = interrupt not masked
  • 1 = interrupt masked (default)

■ im[4] – Interrupt Mask on asynchronous INT 4

  • im[4] bit masks the interrupt on either UART 'A' data ready or transmitter ready.
  • 0 = interrupt not masked
  • 1 = interrupt masked (default)

■ im[3] – Interrupt Mask on asynchronous INT 3

  • im[3] bit masks the external interrupt number 1 (EXTINT[1] pin).
  • 0 = interrupt not masked
  • 1 = interrupt masked (default)

■ im[2] – Interrupt Mask on asynchronous INT 2

  • im[2] bit masks the external interrupt number 0 (EXTINT[0] pin).
  • 0 = interrupt not masked
  • 1 = interrupt masked (default)

■ im[1] – Interrupt Mask on asynchronous INT 1

  • im[1] bit masks the interrupt on masked hardware errors.
  • 0 = interrupt not masked
  • 1 = interrupt masked (default)

Table 4-27. Interrupt Clear Register (INTCLR)

address = 0x 01f8 0050 Supervisor Write
313029282726252423222120191817161514131211109876543210
reserved (0000 0000 0000 0000)WD timeoutEXTINT4RTCTGPTEXTINT3EXTINT2DMA timeoutDMA access errorUART errorcorr. err. in mem.UART BUART AEXTINT1EXTINT0msk.HW errorsreserved (0)
ic
/w/
0000 0000 0000 0000 0000 0000 0000 0000 0000 0

■ ic[15] – Interrupt Clear on asynchronous INT 15

  • ic[15] bit clears as a priority a forced interrupt, else a pending interrupt on the internal or external Watchdog timeout.
  • 0 = interrupt not cleared
  • 1 = interrupt cleared

■ ic[14] – Interrupt Clear on asynchronous INT 14

  • ic[14] bit clears as a priority a forced interrupt, else a pending interrupt on the external interrupt number 4 (EXTINT[4] pin).
  • 0 = interrupt not cleared
  • 1 = interrupt cleared

■ ic[13] – Interrupt Clear on asynchronous INT 13

  • ic[13] bit clears as a priority a forced interrupt, else a pending interrupt on the Real-time Clock Timer.
  • 0 = interrupt not cleared
  • 1 = interrupt cleared

■ ic[12] – Interrupt Clear on asynchronous INT 12

  • ic[12] bit clears as a priority a forced interrupt, else a pending interrupt on the General-purpose Timer.
  • 0 = interrupt not cleared
  • 1 = interrupt cleared

■ ic[11] – Interrupt Clear on asynchronous INT 11

  • ic[11] bit clears as a priority a forced interrupt, else a pending interrupt on the external interrupt number 3 (EXTINT[3] pin).
  • 0 = interrupt not cleared
  • 1 = interrupt cleared

■ ic[10] – Interrupt Clear on asynchronous INT 10

- ic[10] bit clears as a priority a forced interrupt, else a pending interrupt on the external interrupt number 2 (EXTINT[2] pin).

- 0 = interrupt not cleared
- 1 = interrupt cleared 

■ ic[9] – Interrupt Clear on asynchronous INT 9

- ic[9] bit clears as a priority a forced interrupt, else a pending interrupt on a DMA timeout.
- 0 = interrupt not cleared
- 1 = interrupt cleared 

■ ic[8] – Interrupt Clear on asynchronous INT 8

- ic[8] bit clears as a priority a forced interrupt, else a pending interrupt on a DMA access error.
- 0 = interrupt not cleared
- 1 = interrupt cleared 

■ ic[7] – Interrupt Clear on asynchronous INT 7

- ic[7] bit clears as a priority a forced interrupt, else a pending interrupt on a UART error.
- 0 = interrupt not cleared
- 1 = interrupt cleared 

■ ic[6] – Interrupt Clear on asynchronous INT 6

- ic[6] bit clears as a priority a forced interrupt, else a pending interrupt on a correctable error in memory.
- 0 = interrupt not cleared
- 1 = interrupt cleared 

■ ic[5] – Interrupt Clear on asynchronous INT 5

- ic[5] bit clears as a priority a forced interrupt, else a pending interrupt on either UART 'B' data ready or transmitter ready.
- 0 = interrupt not cleared
- 1 = interrupt cleared 

■ ic[4] – Interrupt Clear on asynchronous INT 4

- ic[4] bit clears as a priority a forced interrupt, else a pending interrupt on either UART 'A' data ready or transmitter ready.
- 0 = interrupt not cleared
- 1 = interrupt cleared 

■ ic[3] – Interrupt Clear on asynchronous INT 3

- ic[3] bit clears as a priority a forced interrupt, else a pending interrupt on the external interrupt number 1 (EXTINT[1] pin).
- 0 = interrupt not cleared
- 1 = interrupt cleared 

■ ic[2] – Interrupt Clear on asynchronous INT 2

- ic[2] bit clears as a priority a forced interrupt, else a pending interrupt on the external interrupt number 0 (EXTINT[0] pin).
- 0 = interrupt not cleared 

- 1 = interrupt cleared

■ ic[1] – Interrupt Clear on asynchronous INT 1

- ic[1] bit clears as a priority a forced interrupt, else a pending interrupt on masked hardware errors.

- 0 = interrupt not cleared

- 1 = interrupt cleared

Table 4-28. Interrupt Force Register (INTFCR)

address = 0x 01f8 0054 Supervisor and User Read Supervisor Write
313029282726252423222120191817161514131211109876543210
reserved (0000 0000 0000 0000)WD timeoutEXTINT4RTCTGPTEXTINT3EXTINT2DMA timeoutDMA access errorUART errorcorr. err. in mem.UART BUART AEXTINT1EXTINT0msk.HW errorsreserved (0)
if
rr
0000 0000 0000 0000 0000 0000 0000 00000

■ if[15] – Interrupt Force on asynchronous INT 15

  • if[15] bit forces interrupt on the internal or external Watchdog timeout in test mode (bit it of TESCTR).
  • 0 = interrupt not forced
  • 1 = interrupt forced

■ if[14] – Interrupt Force on asynchronous INT 14

  • if[14] bit forces the external interrupt number 4 (EXTINT[4] pin) in test mode (bit it of TESCTR).
  • 0 = interrupt not forced
  • 1 = interrupt forced

■ if[13] – Interrupt Force on asynchronous INT 13

  • if[13] bit forces the interrupt on the Real-time Clock Timer in test mode (bit it of TESCTR).
  • 0 = interrupt not forced
  • 1 = interrupt forced

■ if[12] – Interrupt Force on asynchronous INT 12

  • if[12] bit forces the interrupt on the General-purpose Timer in test mode (bit it of TESCTR).
  • 0 = interrupt not forced
  • 1 = interrupt forced

■ if[11] – Interrupt Force on asynchronous INT 11

  • if[11] bit forces the external interrupt number 3 (EXTINT[3] pin) in test mode (bit it of TESCTR).
  • 0 = interrupt not forced
  • 1 = interrupt forced

■ if[10] – Interrupt Force on asynchronous INT 10

  • if[10] bit forces the external interrupt number 2 (EXTINT[2] pin) in test mode (bit it of TESCTR).
  • 0 = interrupt not forced
  • 1 = interrupt forced

■ if[9] – Interrupt Force on asynchronous INT 9

  • if[9] bit forces the interrupt on a DMA timeout in test mode (bit it of TESCTR).
  • 0 = interrupt not forced
  • 1 = interrupt forced

■ if[8] – Interrupt Force on asynchronous INT 8

  • if[8] bit forces the interrupt on a DMA access error in test mode (bit it of TESCTR).
  • 0 = interrupt not forced
  • 1 = interrupt forced

■ if[7] – Interrupt Force on asynchronous INT 7

  • if[7] bit forces the interrupt on a UART error in test mode (bit it of TESCTR).
  • 0 = interrupt not forced
  • 1 = interrupt forced

■ if[6] – Interrupt Force on asynchronous INT 6

  • if[6] bit forces the interrupt on a correctable error in memory in test mode (bit it of TESCTR).
  • 0 = interrupt not forced
  • 1 = interrupt forced

■ if[5] – Interrupt Force on asynchronous INT 5

  • if[5] bit forces the interrupt on either UART 'B' data ready or transmitter ready in test mode (bit it of TESCTR).
  • 0 = interrupt not forced
  • 1 = interrupt forced

■ if[4] – Interrupt Force on asynchronous INT 4

  • if[4] bit forces the interrupt on either UART 'A' data ready or transmitter ready in test mode (bit it of TESCTR).
  • 0 = interrupt not forced
  • 1 = interrupt forced

■ if[3] – Interrupt Force on asynchronous INT 3

- if[3] bit forces the external interrupt number 1 (EXTINT[1] pin) in test mode (bit it of TESCTR).

  • 0 = interrupt not forced
  • 1 = interrupt forced

■ if[2] – Interrupt Force on asynchronous INT 2

  • if[2] bit forces the external interrupt number 0 (EXTINT[0] pin) in test mode (bit it of TESCTR).
  • 0 = interrupt not forced
  • 1 = interrupt forced

■ if[1] – Interrupt Force on asynchronous INT 1

  • if[1] bit forces the interrupt on masked hardware errors in test mode (bit it of TESCTR).
  • 0 = interrupt not forced
  • 1 = interrupt forced

4.14 Timer Registers

Table 4-29. Watchdog Timer Register (WDOGTR)

address = 0x 01f8 0060 Supervisor and User Read Supervisor Write
313029282726252423222120191817161514131211109876543210
wdr wds wdc
r/wr/wr/w
1111 11111111 11111111 1111 1111 1111

■ wdr – WatchDog Reset Counter

- wdr field fixes the 'ResetTimeout'. The 'ResetTimeout' is the time between the loading (or re-loading) and the watchdog reset.

$$ \text { ResetTimeout } = \text { Timeout } + 1 6 ^ {w d c s} \cdot \frac {(w d s + 1) \times (w d r + 1)}{W D C L K} $$

Note: The wdcs bit and WDCLK of the formula are respectively the enable bit of the watchdog 4-bit pre-scaler (i.e SYSCTR) and the WDCLK input signal.

- Reading wdr field gives the loading (or re-loading) value, not the effective count value.

■ wds – WatchDog Scaler

  • wds field fixes the scaler for 'ResetTimeout' and 'Timeout' counting.
  • Reading wds field gives the loading (or re-loading) value, not the effective count value.

■ wdc – WatchDog Counter

- wdc field fixes the 'Timeout'. The 'Timeout' is the time between the loading (or re-loading) and the watchdog interrupt. 'ResetTimeout' is greater than 'Timeout'.

$$ \text { Timeout } = 1 6 ^ {\text { wdc } s} \times \frac {(w d s + 1) \cdot (w d c + 1)}{W D C L K} $$

Note: The wdcs bit and WDCLK of the formula are respectively the enable bit of the watchdog 4-bit pre-scaler (i.e SYSCTR) and the WDCLK input signal.

- Reading wdc field gives the loading (or re-loading) value, not the effective count value.

Table 4-30. Watchdog Trap Door Set (WDOGST)

address = 0x 01f8 0064 Supervisor Write
313029282726252423222120191817161514131211109876543210
...
w
/

Write only with any data. A write to this register after reset but before the watchdog has elapsed will disable the watchdog. The watchdog will stay disabled until it is reprogrammed by writing to the Watchdog Timer Register (WDOGTR).

Table 4-31. Real-time Clock Timer Register (RTCCR)

address = 0x 01f8 0080 Supervisor and User Read Supervisor Write
313029282726252423222120191817161514131211109876543210
rtcc
r/w
1111 1111 1111 1111 1111 1111 1111 1111

■ rtcc – Real-time Clock Timer Counter

  • rtcc field has 2 meanings:
  • A write access programs the pre-loading of the counter (do not program rtcc = 0).
    – A read access gives the decounting value of the counter.
  • The 'RTCTimeout' is the time between the loading (or re-loading) and the RTC interrupt.

$$ i f \quad r t c s > 0 > \quad t h e n \quad R T C T i m e o u t = \frac {r t c c \times (r t c s + 1)}{S Y S C L K} $$

$$ i f \quad r t c s = 0 \quad \text { then } \quad R T C T i m e o u t = \frac {r t c c + 1}{S Y S C L K} $$

Note: The SYSCLK of the formula is the SYSCLK output signal.

Table 4-32. Real-time Clock Timer Register (RTCSR)

address = 0x 01f8 0084 Supervisor and User Read Supervisor Write
313029282726252423222120191817161514131211109876543210
reserved (0000 0000 0000 0000 0000 0000 0000)rtcs
r0000 0000 0000 0000 0000 0000 0000 0000

4-90 TSC695F User Manual

Microchip TSC695F - ■ rtcc – Real-time Clock Timer Counter - 1

■ rtcs – Real-time Clock Timer Scaler

  • rtcs field has 2 meanings:
  • A write access programs the pre-loading of the scaler.
  • A read access gives the discounting value of the scaler.

Table 4-33. General-purpose Timer Register (GPTCR)

address = 0x 01f8 0088 Supervisor and User Read Supervisor Write
313029282726252423222120191817161514131211109876543210
gptc
r/w1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111

■ gptc – General-purpose Timer Counter

- gptc field has 2 meanings:

  1. A nwrite access programs the pre-loading of the counter (do not program gptc = 0).
  2. A read access gives the discounting value of the counter.

- The 'GPTTimeout' is the time between the loading (or re-loading) and the GPT interrupt.

$$ i f \quad g p t s \quad 0 > \quad t h e n \quad G P T T i m e o u t = \frac {g p t c \times (g p t s + 1)}{S Y S C L K} $$

$$ i f \quad g p t s = 0 \quad t h e n \quad G P T T i m e o u t = \frac {g p t c + 1}{S Y S C L K} $$

Note: The SYSCLK of the formula is the SYSCLK output signal.

Table 4-34. General-purpose Timer Register (GPTSR)

address = 0x 01f8 008c Supervisor and User Read Supervisor Write
313029282726252423222120191817161514131211109876543210
reserved (0000 0000 0000 0000)gpts
rr/wr/wr/wr/w
0000 0000 0000 00001111 1111 1111 1111 1111

■ gpts – General-purpose Timer Scaler

- gpts field has 2 meanings

  1. A write access programs the pre-loading of the scaler.
  2. A read access gives the discounting value of the scaler.

Timer Control Register
Table 4-35. Timer Control Register (TIMCTR)

address = 0x 01f8 0098 Supervisor and User Read Supervisor Write
313029282726252423222120191817161514131211109876543210
reserved (0000 0000 0000 0000 0000 0000)rtcslrtcertcclrtcrreserved (0)bhltahltphltgptslgptegptclgptr
rr
0000 0000 0000 0000 0000 000000000000000000

■ rtcs/ – Real-time Clock Scaler Load

  • rtcs1 bit loads the RTC scaler with the preset value and the RTC scaler starts if it is enabled.
  • 0 = no function
  • 1 = load scaler

■ rtce – Real-time Clock Enabled

  • rtce bit enables the counting for the RTC.
  • 0 = hold scaler and counter
  • 1 = enable counting

■ rtccl – Real-time Clock Counter Load

- rtccl bit loads the RTC counter with the preset value and the RTC counter starts if it is enabled.

  • 0 = no function
  • 1 = load scaler

■ rtcr – Real-time Clock Reload

  • rtcr bit enables the 'reload' mode or 'one-shot' mode for the RTC.
  • 0 = 'one-shot' mode
  • 1 = 'reload' mode

■ bhlt – UART 'B' HaLT

  • bhlt bit gives the possibility to disable the UART 'B' clock for software debugging. This effect of this bit is enabled by the DEBUG pin.
  • 0 = UART 'B' not halted (default)
  • 1 = UART 'B' not halted

■ ahlt – UART 'A' HaLT

  • ahlt bit gives the possibility to disable the UART 'A' clock for software debugging. This effect of this bit is enabled by the DEBUG pin.
  • 0 = UART 'A' not halted (default)
  • 1 = UART 'A' not halted

■ phlt – Peripherals HaLT

  • phlt bit gives the possibility to disable the watchdog timer, the RTC timer and the GPT timer for software debugging. This effect of this bit is enabled by the DEBUG pin.
  • 0 = peripherals not halted (default)
  • 1 = peripherals not halted

■ gptsl – General-purpose Timer Scaler Load

  • gptsl bit loads the GPT scaler with the preset value and the GPT scaler starts if it is enabled.
  • 0 = no function
  • 1 = load scaler

■ gpte – General-purpose Timer Enabled

  • gpte bit enables the counting for the GPT.
  • 0 = hold scaler and counter
  • 1 = enable counting

■ gptcl – General-purpose Timer Counter Load

  • gptcl bit loads the GPT counter with the preset value and the GPT counter starts if it is enabled.
  • 0 = no function
  • 1 = load scaler

■ gptr – General-purpose Timer Reload

  • gptr bit enables the 'reload' mode or 'one-shot' mode for the GPT.
  • 0 = 'one-shot' mode
  • 1 = 'reload' mode

4.15 Interface

Registers

Table 4-36. GPI Configuration Register (GPICNFR)

address = 0x 01f8 00a8 Supervisor and User Read Supervisor Write
313029282726252423222120191817161514131211109876543210
reserved (0000 0000 0000 0000) r/fi/o
rr/wr/wr/wr/w
0000 0000 0000 00000000 0000

■ r/f – Falling edge/Rising edge

  • r/f field only configures GPI input pins to generate a interrupt 2xSYSCLK positive pulse on GPIINT pin.
  • 0 = falling edge
  • 1 = rising edge

■ i/o – Input/Output configuration

- i/o field configures GPI input/output pins as input or output pins. A pin declared as output cannot generate an interrupt on GPIINT pin.

-0 = input
- 1 = output

Table 4-37. GPI Data Register (GPIDATR)

address = 0x 01f8 00ac Supervisor and User Read Supervisor Write
313029282726252423222120191817161514131211109876543210
reserved (0000 0000 0000 0000 0000 0000 0000) gpid
r/wr/w0000 0000 0000 0000 0000 0000 0000 0000

■ gpid – GPI Data

- gpid field contents the bit value of GPI[7:0] input/output pins.

Writing gpid field only sets or resets the GPI[7:0] pins configured as output in i/o field of GPI configuration register.

Reading gpid field indicates the logical level applied to GPI[7:0] pins, as well pins declared as input than those declared as output by i/o field of GPI configuration register.

gpidState
gpid[0]logical level ^for / _of GPI[0] pin
gpid[1]logical level ^for / _of GPI[1] pin
gpid[2]logical level ^for / _of GPI[2] pin
gpid[3]logical level ^for / _of GPI[3] pin
gpidState
gpid[4] logical level for/of GPI[4] pin
gpid[5] logical level for/of GPI[5] pin
gpid[6] logical level for/of GPI[6] pin
gpid[7] logical level for/of GPI[7] pin

Table 4-38. UART 'A' Rx and Tx Register (UARTAR)

address = 0x 01f8 00e0 Supervisor and User Read Supervisor Write
313029282726252423222120191817161514131211109876543210
reserved (0000 0000 0000 0000 0000 0000 0000)rtda
r0000 0000 0000 0000 0000 0000 0000

■ rtda – Received or Transmitted Data of UART 'A'

- rtda field has 2 meanings

  1. A write access enables the sending of the written 8-bit data on UART 'A'.
  2. A read access provides the received 8-bit data on UART 'A'.

Table 4-39. UART 'B' Rx and Tx Register (UARTBR)

address = 0x 01f8 00e4 Supervisor and User Read Supervisor Write
313029282726252423222120191817161514131211109876543210
reserved (0000 0000 0000 0000 0000 0000 0000) rtdb
rr/w
0000 0000 0000 0000 0000 0000 0000

■ rtdb – Received or Transmitted Data of UART 'B'

- rtdb field has 2 meanings

  1. A write access enables the sending of the written 8-bit data on UART 'B'.
  2. A read access provides the received 8-bit data on UART 'B'.

Table 4-40. UART Status Register (UARTSR)

address = 0x 01f8 00e8 Supervisor and User Read Supervisor Write
313029282726252423222120191817161514131211109876543210
reserved(0000)cuboebpebfebreserved (0)thebtsebdrbreserved(0000)cuaoeapeafeareserved (0)theatseadra
rr/wrrrrr/wrrr
0000 0000000001100000 000000000110

■ cub – Clear Errors on UART 'B'

  • cub bit clears the setting errors (oeb/peb/feb) on the UART 'B'. It is an auto-resetable bit (bit read as zero).
  • 0 = no action
  • 1 = clear errors on UART 'B'

■ oeb – Overrun Error on receiver 'B'

- oeb bit advises an overrun error on the receiver of UART 'B'. When a byte is received while the receiver already contents a non-read byte, only the oeb bit is set, not the drb bit. The last received byte is lost. The oeb bit is cleared by the cub bit.

-0 = no error
- 1 = overrun error on the receiver of UART 'B'

■ peb – Parity Error on receiver 'B'

  • peb bit advises a parity error on the receiver of UART 'B'. When a byte is received with a parity error, only the peb bit is set, not the drb bit. The peb bit is cleared by the cub bit.
    -0 = no error
  • 1 = parity error on the receiver of UART 'B'

■ feb – Frame Error on receiver 'B'

  • feb bit advises a frame error on the receiver of UART 'B'. When a byte is received with a frame error, only the feb bit is set, not the drb bit. The feb bit is cleared by the cub bit.
    -0 = no error
  • 1 = frame error on the receiver of UART 'B'

■ theb – Transmitter Holding Register Empty on UART 'B'

  • theb bit indicates the transmitter holding register of the UART 'B' is empty. It is ready to be reloaded with a new data.
  • 0 = full
  • 1 = empty (default)

■ tseb – Transmitter Send Register Empty on UART 'B'

  • tseb bit indicates the transmitter send register of the UART 'B' is empty. It has no data to send.
  • 0 = full
  • 1 = empty (default)

■ drb – Data Ready in UART 'B'

  • drb bit indicates a data has been received by the receiver of the UART 'B'.
  • 0 = empty (default)
  • 1 = full

■ cua – Clear Errors on UART 'A'

  • cua bit clears the setting errors (oea/pea/fea) on the UART 'A'. It is an auto-resetable bit (bit read as zero).
  • 0 = no action
  • 1 = clear errors on UART 'A'

- oea – Overrun Error on receiver 'A'

  • oea bit advises an overrun error on the receiver of UART 'A'. When a byte is received while the receiver already contents a non-read byte, only the oea bit is set, not the dra bit. The last received byte is lost. The oea bit is cleared by the cua bit.
    -0 = no error
  • 1 = overrun error on the receiver of UART 'A'

■ pea – Parity Error on receiver 'A'

  • pea bit advises a parity error on the receiver of UART 'A'. When a byte is received with a parity error, only the pea bit is set, not the dra bit. The pea bit is cleared by the cua bit.
    -0 = no error
  • 1 = parity error on the receiver of UART 'B'

■ fea – Frame Error on receiver 'A'

  • fea bit advises a frame error on the receiver of UART 'A'. When a byte is received with a frame error, only the fea bit is set, not the dra bit. The fea bit is cleared by the cua bit.
    -0 = no error
  • 1 = frame error on the receiver of UART 'A'

■ thea – Transmitter Holding Register Empty on UART 'A'

- thea bit indicates the transmitter holding register of the UART 'A' is empty. It is ready to be reloaded with a new data.

$$ \begin{array}{l} - 0 = f u l l \ - 1 = \text { empty (default) } \ \end{array} $$

■ tsea – Transmitter Send Register Empty on UART 'A'

- tsea bit indicates the transmitter send register of the UART 'A' is empty. It has no data to send.

$$ \begin{array}{l} - 0 = f u l l \ - 1 = \text { empty (default) } \ \end{array} $$

■ dra – Data Ready in UART 'A'

- dra bit indicates a data has been received by the receiver of the UART 'A'.

$$ - 0 = \text { empty (default) } $$

$$ - 1 = f u l l $$

Signals Description

5.1 IU and FPU Signals

■ RA[31:0] – Registered Address Bus (output/input)

The address bus for the TSC695F is an output bus. Inside the processor, the IU address bus is used to perform decoding, to generate select signals and to check against the memory access protection scheme. It is also used to address the system registers. To save board space, the address bus is sent out registered for external resources. This means that internal D-type flip-flop's are implemented inside the TSC695F to memorize the IU address bus at each rising edge of SYSCLK enabled by (ALE*) signal. This registered address bus is always driven by the TSC695F even during system registers accesses.

In case of DMA session, the address bus for the TSC695F is an input bus. The DMA unit must drive itself to the registered address bus for the available parts of the processor during a DMA session and for the external resources (SRAMs, ROMs, I/Os, ...).

Organization and addressing of data in memory follows the 'Big-Endian' convention wherein lower addresses contain the higher-order bytes. Attempting to access mis-aligned data will generate a memory_address_not_aligned' trap (tt = 0x07).

63 Doubleword 0
31 Word 031 Word 0
15 Halfword 015 Halfword 015 Halfword 015 Halfword 0
7 Byte 0 7 Byte0 7 Byte 0 7Byte 0 7 Byte 07 Byte 0 7 Byte0 7 Byte 0
NN+1N+2N+3N+4N+5N+6N+7

■ RAPAR – Registered Address Bus Parity (output/input)

This output is the odd parity over the 32-bit IU address bus. To save board space, this signal is sent out registered and has the same timing as RA[31:0].

In case of DMA session, this signal must be driven by the DMA unit if DMA parity is enabled. This input requires the same timing as RA[31:0].

■ RASI[3:0] – Registered Address Space Identifier (output/input)

These four bits constitute the Address Space Identifier (ASI), which identifies the memory address space to which the instruction or data access is being directed. The ASI bits

Address

TSC695F User Manual 5-98

are provided to detect supervisor or user mode, instruction or data access. Inside the processor, these identifiers are used to control accesses to on-chip peripherals. To save board space, these outputs are sent out registered and has the same timing as RA[31:0].

In case of DMA session, these signals must be driven by the DMA unit. These inputs require the same timing as RA[31:0].

Table 5-1. RASI Assignments

RASI[3:0] codeDefinition
1000_b (0x8) User instruction
1010_b (0xA) User data
1001_b (0x9) Supervisor instruction
1011_b (0xB) Supervisor data

■ RSIZE[1:0] – Registered Bus Transaction Size (output/input)

The coding on these pins specifies the size of the data being transferred during an instruction or a data fetch. To save board space, these outputs are sent out registered and has the same timing as RA[31:0].

Table 5-2. RSIZE Assignments

RSIZE[1] RSIZE[0] Data Transfer Type
00B y
0 1 Half-word (16 bits)
1 0 Word (32 bits)
1 1 Word (load/store double)

In the ROM area (Boot PROM + Extended PROM) structured in 8-bit mode, the load word or instruction fetch is converted in four read accesses. Only store byte (stb instruction) is allowed.

In the ROM area structured in 40-bit mode, byte, half-word and word read access is allowed, but only store word (st instruction) can be supplied.

In the Exchange Memory area, only word access is allowed.

Only word access to System Registers is allowed.

In the RAM area (RAM + Extended RAM), a store subword (byte or half-word) is implemented as a read-modify-write word since check-bits must be generated over word. In spite of this implementation, RSIZE[1:0] keeps its initial value. Byte or half-word read access is allowed.

Since the I/O unit never includes EDAC check bits, the store subword (half-word or byte) instruction in the I/O area is different from the store subword in the RAM area. In the I/O area (I/O area [3:0] + I/O area), a store subword is implemented as a store word from a timing point of view, but the subword (byte or half-word) is repeated by the IU on the other subwords in the full word.

Figure 5-1. Byte Operand Load and Store
Microchip TSC695F - IU and FPU Signals - 1

text_image Memory Location Address N N+1 N+2 N+3 2431 1623 815 07 Destination Register 31 Zeroes or Sign Extension 8 7 0 Byte load example (from address N+1) Data Bus Address N N+1 N+2 N+3 2431 1623 815 07 (*) (*) (**) (*) Source Register 31 Don't Care 8 7 0 (*) The irrelevant bytes of the data bus are filled with the stored data byte (idem for half-word). Byte store example (from address N+2)

The Extended general area works (without parity) as I/O areas.

A DMA unit must drive these bits to '10', since only word transfers are allowed in DMA mode.

■ RASPAR – Registered RASI and RSIZE Buses Parity (output/input)

This output is the odd parity over the RASI[3:0] and the RSIZE[1:0] signals. To save board space, this output is sent out registered and has the same timing as RA[31:0].

In case of DMA session, this signal must be driven by the DMA unit if DMA parity is enabled. This input requires the same timing as RA[31:0].

■ CPAR – Control Bus Parity (output/input)

This output is the odd parity over the RLDSTO, DXFER, LOCK, WRT, RD and WE (WE*) signals. This signal is sent out unregistered and must be latched externally before it is used.

In case of DMA session, this signal must be driven by the DMA unit if DMA parity is enabled.

■ D[31:0] – Data Bus (bidirectional)

These signals form a 32-bit bidirectional data bus that serves as the interface between the TSC695F and external memory. The data bus is not driven by the TSC695F during system registers accesses, it is only driven during the execution of integer and floating-point store instructions and the store cycle of atomic-load-store instructions on external memory.

Store data is valid during the second data cycle of a store single access, the second and third data cycle of a store double access, and the third data cycle of an atomic-load-store access.

Alignment for load and store instructions is performed by the processor. Doublewords are aligned on 8-byte boundaries, words on 4-byte boundaries, and half-words on 2-byte boundaries. If a doubleword, word, or half-word load or store instruction generates an improperly aligned address, a memory address not aligned trap will occur. Instructions and operands are always expected to reside in a 32-bit wide memory. D[31] corresponds to the most significant bit of the most significant byte of a 32-bit word going to or from memory.

■ DPAR – Data Bus Parity (bi-directional)

This pin is used by the TSC695F to check and generate the odd parity over the 32-bit data bus during write cycles.

$$ D P A R = \text { not } (D [ 3 1 ] \text { xor } D [ 3 0 ] \text { xor } \ldots \text { xor } D [ 1 ] \text { xor } D [ 0 ]) $$

In case of DMA session, this signal must be driven by the DMA unit if DMA parity is enabled.

■ CB[6:0] – Check Bits (bi-directional)

CB[6:0] is the EDAC checkword over the 33-bit data bus consisting of D[31:0] and the parity bit (DPAR). When the TSC695F performs a write operation to the main memory, it will assert the EDAC checkword on the CB[6:0]. During read access from the main memory, CB[6:0] are input signals and will be used for checking and correction of the data word and the parity bit. During read access to areas which do not generate a parity bit, the TSC695F will latch the data from the accessed address and drive the correct parity bit to IU or FPU (not observable).

Bit ParityD [31:0] (* indicates bit of D[31:0] used in parity calculation)
313029282726252423222120191817161514131211109876543210
D P A RN.XOR***************************
C B [ 6 ]XOR****************
CB [5]XOR****************
CB [4]N.XOR****************
C B [ 3 ]XOR*****************
CB [2]N.XOR****************
CB [1]XOR****************
C B [ 0 ]XOR****************

■ RLDSTO – Registered Atomic Load-Store (output/input)

This signal is used to identify an atomic load-store (LDSTUB instruction only) to the system and is asserted by the IU during all the data cycles (the load cycle and both store cycles) of atomic load-store instructions. To save board space, LDSTO is sent out registered.

In case of DMA session, this signal must be driven unlatched by the DMA unit.

■ ALE (ALE*) - Address Latch Enable (output)

This output is asserted when the internal address bus from the IU is to be latched. This latch operation is assumed by the internal latch.

In case of DMA session, this signal is intended to be used to enable the clock input (SYSCLK) of an external flip-flop used to latch the generated address from DMA unit.

■ DXFER – Data Transfer (output/input)

DXFER is used to differentiate between the addresses being sent out for instruction fetches and the addresses of data fetches. DXFER is asserted by the processor during the address cycles of all bus data transfer cycles, including both cycles of store single and all three cycles of store double and atomic load-store. DXFER is sent out unregistered and must be latched externally before it is used.

A DMA unit must supply this signal during a DMA session.

■ LOCK – Bus Lock (output/input)

LOCK is asserted by the processor when it needs to retain control of the bus (address and data) for multiple cycle transactions (Load Double, Store Single and Double, Atomic Load-Store). The bus will not be granted to another bus master as long as LOCK is asserted. Note that MHOLD (MHOLD*), when it reflects the internal signal 'Bus Hold', should not be asserted in the processor clock cycle which follows a cycle in which LOCK is asserted. LOCK is sent out unregistered and must be latched externally before it is used.

A DMA unit must supply this signal during a DMA session.

■ RD – Read Access (output/input)

RD is sent out during the address portion of an access to specify whether the current memory access is a read (RD = 1) or a write (RD = 0) operation. RD is set low only during the address cycles of store instructions. For atomic load-store instructions, RD is set high during the load address cycle and set low during the two store address cycles. RD may be used, in conjunction with SIZE[1:0], ASI[7:0], and LDSTO, to determine the type and to check the read/write access rights of bus transactions in the Extended General area. It is sent out unregistered and must be latched externally before it is used.

A DMA unit must supply this signal during a DMA session.

■ (WE*) – Write Enable (output/input)

WE (WE*) is asserted by the IU during the cycle in which the store data is on the data bus. For a store single instruction, this is during the second store address cycle, the second and third store address cycles of store double instructions and the third load-store address cycle of atomic load-store instructions. To avoid writing to memory during memory exceptions, WE must be externally qualified by the MHOLD(MHOLD*), when this holding reflects the internal signal 'Memory Hold'. It is sent out unregistered and must be latched externally before it is used.

A DMA unit must supply this signal during a DMA session, asserted low for write and deasserted high for read accesses.

■ WRT – Advanced Write (output/input)

WRT is an early write signal, asserted by the processor during the first store address cycle of integer single or double store instructions, the first store address cycle of floating-point single or double store instructions, and the second load-store address cycle of atomic load-store instructions. WRT is sent out unregistered and must be latched externally before it is used.

A DMA unit must supply this signal during a DMA session, deasserted low for read and asserted high for write accesses.

■ MHOLD (MHOLD*) – Memory Bus Hold (output)

This signal is asserted when a 'Memory Hold' (MHOLD) or a 'Floating-point Hold' (FHOLD) or a 'Floating-point Condition Codes Valid' (FCCV) or a 'Bus Hold' (BHOLD) is internally generated.

Note that (MHOLD*) must be driven HIGH while (RESET*) is LOW.

• ' Memory Hold'

'Memory Hold' is used to freeze the pipeline to both the IU and FPU accessing a slow memory or during memory exception. The IU and FPU internal outputs return to and stay at the value they had on the rising edge of SYSCLK in the cycle in which

'Memory Hold' was asserted. 'Memory Hold' is tested on the falling edge (midpoint of cycle) of SYSCLK. The memory wait state controller of the TSC695F inserts, in this way, wait states during external accesses.

- 'Floating-point Hold'

'Floating-point Hold' is asserted by the FPU if a situation arises in which the FPU cannot continue execution. The FPU checks all dependencies in the decode stage of the instruction and asserts a 'Floating-point Hold' (if necessary) in the next cycle. If the IU receives a 'Floating-point Hold', it freezes the instruction pipeline in the same cycle. Once the conditions causing the 'Floating-point Hold' are resolved, the FPU deasserts its command, releasing the instruction pipeline. A 'Floating-point Hold' is asserted if:

  • The FPU encounters an STFSR instruction with one or more FPops pending in the queue,
  • Either a resource or operand dependency exists between the FPop being decoded and any FPops already being executed,
    – The floating-point queue is full.

- 'Floating-point Condition Codes Valid'

'Floating-point Condition Codes Valid' is a specialized hold used to synchronize FPU compare instructions with floating-point branch instructions. It is asserted (the normal condition) whenever the 'Floating-point Condition Codes' bits (FCC[1:0]) are valid. The FPU deasserts these bits (= '0') as soon as a floating-point compare instruction enters the floating-point queue, unless an exception is detected. Deasserting the 'Floating-point Condition Codes' bits freezes the IU pipeline, preventing any further compares from entering the pipeline. The 'Floating-point Condition Codes' bits are reasserted when the compare is completed and the condition codes are valid, thus ensuring that the condition codes match the proper compare instruction.

• ' B u s H o l d '

'Bus Hold' is asserted during DMA accesses. Assertion of this hold signal will freeze the processor pipeline, so after deassertion of 'Bus Hold', external logic must guarantee that the data at all inputs to the TSC695F is the same as it was before 'Bus Hold' was asserted. This hold signal is tested on the falling edge (midpoint of cycle) of SYSCLK.

■ MDS (MDS*) – Memory Data Strobe (output)

MDS (MDS*) is asserted by the memory access controller of the TSC695F to enable the clock to the IU's instruction register (during an instruction fetch) or to the load result register (during a data fetch) while the pipeline is frozen with an MHOLD(MHOLD*). In a system with slow memories, MDS (MDS*) tells the processor when the read data is available on the bus. MDS (MDS*) is also used to strobe in the MEXC (MEXC*) memory exception signal. MDS (MDS*) is only asserted when the pipeline is frozen with MHOLD(MHOLD*).

■ MEXC (MEXC*) – Memory Exception (output)

Assertion of this signal by the memory access controller of the TSC695F initiates a memory exception and indicates to the IU that the memory system was unable to supply a valid instruction or data. If (MEXC*) is asserted during an instruction fetch cycle, it generates an instruction access exception trap (tt = 1). If asserted during a data cycle, it generates a data access exception trap (tt = 9). It denotes a parity error, uncorrectable EDAC error, access violation, bus timeout or system bus error is detected.

MEXC (MEXC*) is used as a qualifier for the MDS (MDS*) signal, and is asserted when both MHOLD (MHOLD*) and MDS (MDS*) are already asserted. If MDS (MDS*) is

applied without MEXC (MEXC*), the TSC695F accepts the contents of the data bus as valid. If MEXC (MEXC*) accompanies MDS (MDS*), an exception is generated and the data bus content is ignored.

MEXC (MEXC*) is latched in the IU on the rising edge of SYSCLK and is used in the following cycle. MEXC (MEXC*) is deasserted in the same clock cycle in which MHOLD (MHOLD*) is deasserted.

If this signal is asserted during a DMA transfer, the DMA must withdraw its DMA request and end the DMA cycle.

5.2 Memory and System Interface Signals

■ PROM8 (PROM8*) – Select 8-bit Wide PROM (input)

This input indicates that only 8-bit wide PROM is connected to the TSC695F. The eight data lines from the PROM is to be connected to the D[7:0] signals. The processor will perform a 8-bit to 32-bit conversion when the IU reads from the PROM (the conversion is not visible on data bus). There is no EDAC or parity checking on accesses to the PROM when 8 ( 8^ ) is asserted, and EDAC and parity bits must be supplied by the PROM when 8 ( 8^ ) is deasserted.

■ BA[1:0] – Boot PROM Latched Address used for 8-bit Wide PROM (output)

These outputs are used when 8-bit wide PROM is connected to the TSC695F.

During a fetch or 32-bit load access to the PROM, the BA[1:0] will be asserted four times in order to get the four bytes needed to generate a 32-bit word. The TSC695F will assert the following sequence:

Table 5-3. 8-bit Wide PROM Read Access Sequence

Sequence BA[1:0] Bits in the 32-bit wordComments
32-bit load (or fetch)0 00/ 1 extra cycle
1 00[31:24] Load of n (wait states) cycles
2 01[23:16] Load of n (wait states) cycles
3 10[15:8] Load of n (wait states) cycles
4 11[7:0] Load of n (wait states) cycles
5 00/ Internal load 0 wait state

During store byte (only stb instruction is allowed in 8-bit wide PROM), BA[1:0] is equivalent to RA[0:1].

■ ROMCS (ROMCS*) – ROM Chip Select (output)

This output is asserted whenever there is an access to the boot ROM area. It can be connected directly to the ROM chip select pins.

■ ROMWRT (ROMWRT*) – ROM Write Enable (input)

Assertion of this signal will enable the pwr bit of the Memory Configuration Register (MCNFR). This logic allows the on-board programming (write operations) of the boot PROM when EEPROM or FLASH devices are used.

■ MEMCS[9:0] (MEMCS*[9:0]) – Memory Chip Select (output)

[9:0] (MEMCS*[9:0]) is asserted during an access to the main memory. [9:8] (MEMCS*[9:8]) are redundant signals, used to substitute any of the nominal memory banks when memory connected to any of [7:0] (MEMCS*[7:0]) malfunctions.

■ MEMWR (MEMWR*) – Memory Write (output)

MEMWR (MEMWR*) is asserted during write access (store) to boot PROM area, extended PROM area, RAM area and extended RAM area. It is intended to be used as write strobe to the memory devices.

■ ( OE^* ) – Output Enable (output)

(OE*) is asserted during fetch or load accesses to the main memory. It is intended to be used to control memory devices with output enable features.

■ BUFFEN (BUFFEN*) – Data Buffer Enable (output)

BUFFEN (BUFFEN*) is asserted during memory accesses excepted in RAM area (RAM area does not needs data buffers). It is intended to be used as buffer enable for data, check and parity bit buffers in the boot PROM area, extended PROM area, exchange memory area, extended RAM area, I/O area, extended I/O area and extended general area if these areas share the same buffers.

■ DDIR – Data Buffer Direction (output)

DDIR is used for determining the direction of the data buffers enabled by BUFFEN (BUFFEN ^* ). It is valid during all memory accesses. The DDIR is asserted high during store operations.

■ (DDIR*) – Data Buffer Direction (output)

(DDIR*) is used for determining the direction of the data buffers enabled by (BUFFEN*). It is valid during all memory accesses. The DDIR is asserted high during fetch or load operations.

■ IOSEL[3:0] (IOSEL*[3:0]) – IO Chip Select (output)

These four select signals are used to enable one of four possible I/O address areas.

■ IOWR (IOWR*) - IO Write (output)

IOWR (IOWR*) is asserted during write operations to the I/O area, extended I/O area and the exchange memory area.

■ EXMCS (EXMCS*) – Exchange Memory Chip Select (output)

EXMCS (EXMCS*) is asserted when the exchange memory is accessed.

■ BUSRDY (BUSRDY*) – Bus Ready (input)

BUSRDY (BUSRDY ^* ) is to be generated by a unit in the I/O area, exchange memory area or in the extended areas, which requires extended time when accessed in addition to the preprogrammed number of wait states. (Note however that waitstates can not be preprogrammed for units in the extended general area, only for extended I/O, boot PROM and RAM)

5.3 Error, DMA, Halt and Check Signals

■ (BUSERR*) – Bus Error (input)

BUSERR (BUSERR*) is to be generated together with BUSRDY (BUSRDY*) by a unit in the I/O area, exchange memory area or in the extended areas if an error is detected by the accessed unit during an access.

Table 5-4. Bus Transaction Response Signals

BUSERR* BUSRDY* Action
H H Nothing (not ready)

Table 5-4. Bus Transaction Response Signals

BUSERR* BUSRDY* Action
H L Data Strobe (ready)
L H Nothing (not ready)
L L System Bus Error

■ DMAREQ (DMAREQ*) – DMA Request (input)

DMAREQ (DMAREQ*) is to be issued by a unit requesting the access to the processor bus as a master. The TSC695F can include a DMA session timeout function preventing the DMA unit to lockout the IU/FPU by asserting DMA request for a long time.

■ DMAGNT (DMAGNT*) – DMA Grant (output)

DMAGNT (DMAGNT*) is generated by the TSC695F as a response to a DMAREQ (DMAREQ*). DMAGNT (DMAGNT*) is sent after that the TSC695F has asserted a 'Bus Hold'. A memory cycle started by the processor is not interrupted by a DMA access before it is finished.

The DMA unit have access to all system registers and all integrated peripherals of the TSC695F. It also has access to the memory controlled by the memory access controller of the TSC695F.

■ DMAAS – DMA Address Strobe (input)

During DMA transfers (when the external DMA is bus master) this input is used to inform the TSC695F that the address from the DMA is valid and that the access cycle shall start. DMAAS can be asserted multiple times during DMA grant.

DMAAS must be shaped close to one SYSCLK high pulse. A good way to perform it is to synchronise with SYSCLK – the asynchronous signal coming from your DMA controller.

Figure 5-2. DMAS Timing

SYSCLK RA[31:0] asynchronous DMAAS synchronised DMAAS (to TSC695F input)

Microchip TSC695F - Error, DMA, Halt and Check Signals - 1

flowchart
graph TD
    A["Start"] --> B{Signal Flow}
    B --> C{Timing Point}
    C -->|Path 1| D["End"]
    C -->|Path 2| E["End"]
    C -->|Path 3| F["End"]
    style A fill:#f9f,stroke:#333
    style D fill:#ccf,stroke:#333
    style E fill:#ccf,stroke:#333
    style F fill:#ccf,stroke:#333

■ DRDY (DRDY*) – Data Ready during DMA access (output)

During DMA read transfers (when the external DMA is bus master) this output is used to inform the DMA unit that the data are valid. During DMA write transfers this signal indicates that data have been written into memory.

■ (IUERR*) - IU Error (output)

This signal is asserted when the (master) IU enters the 'error mode' state. This happens if a synchronous trap occurs while traps are disabled (the %PSR's et bit = 0). Before it enters the error mode state, the TSC695F saves the %PC and %nPC and sets the trap type (tt) for the trap causing the error mode into the %TBR. It then asserts the error signal and halts. The only way to restart a processor which is in the error mode state is to trigger a reset by asserting the RESET (RESET*) signal.

■ SYSERR (SYSERR*) – System Error (output)

This signal is asserted whenever an unmasked error is set in the Error and Reset Status Register (ERRRSR). It stays asserted until the ERRRSR is cleared. The error can origi-

nate from either the IU (IU error ar IU hardware error) or the system registers (system hardware error). SYSERR* and IUERR* are used to signal to the application system.

■ SYSHALT (SYSHALT*) – System Halt (input)

Assertion of this pin will halt the TSC695F, freezing IU/FPU execution. SYSCLK and internal CLK2 are running but all the timers and Watchdog are halted and the UART operation is stopped.

DMA accesses are allowed during halt mode.

When SYSHALT is deasserted, the previous mode is entered.

■ CPUHALT (CPUHALT*) – Processor (IU and FPU) Halt (output)

This output informs that the IU and the FPU are in 'halt' mode. It can be used to halt other units in the system.

CPUHALT signal is also used to advise the 'freeze' mode generated by the OCD.

■ SYSAV – System Availability (output)

This signal is asserted whenever the system is available, i.e., when the sysav bit in the ERRRSR is set and the CPUHALT (CPUHALT*) and SYSERR (SYSERR*) signals are deasserted. The sysav bit is cleared by reset and is programmable by software.

■ NOPAR (NOPAR*) – No Parity (input)

Assertion of this signal will disable the parity checking of all signals related to the TSC695F internal buses. The parity generation on the data bus (towards memory and I/O units) is not affected by this signal, but note that parity checking is disabled if NOPAR (NOPAR*) is asserted. This is a static signal and shall not change when running.

When this signal is asserted (no parity), it disables the epa and rpa bits of the Memory Configuration Register (MCNFR) and the pa3, pa2, pa1 and pa0 bits of the I/O Configuration Register.

■ INULL – Integer Unit Nullify Cycle (output)

The processor asserts INULL to indicate that the current memory access is being nullified. It is asserted at the beginning of the cycle in which the address being nullified is active. INULL is used to disable memory exception generation for the current memory access. This means that MDS (MDS*) and MEXC (MEXC*) is not be asserted for a memory access in which INULL = 1.

INULL is asserted under the following conditions:

  1. During the second data cycle of any store instruction (including Atomic Load-Store) to nullify the second occurrence of the store address

  2. On all traps, to nullify the third instruction fetch after the trapped instruction. For reset, it nullifies the error-producing address

  3. On a load in which the hardware interlock is activated

  4. on JMPL and RETT instructions

■ INST – Instruction Fetch (output)

The INST signal is asserted by the IU whenever a new instruction is being fetched. It is used by the FPU to latch the instruction currently on the internal data bus into an FPU instruction buffer. The FPU have two instruction buffers (D1 and D2) to save the last two fetched instructions. When INST is asserted, a new instruction enters buffer D1 and the instruction that was in D1 moves to buffer D2.

■ FLUSH – FPU Instruction Flush (output)

This signal is asserted by the IU whenever it takes a trap. FLUSH is used by the FPU to flush the instructions in its instruction buffers. These instructions, as well as the instructions annulled in the IU pipeline, are restarted after the trap handler is finished. If the trap was not caused by a Floating-point exception, instructions already in the Floating-point queue may continue their execution. If the trap was caused by a Floating-point exception, the FP queue must be emptied before the FPU can resume execution.

■ DIA – Delay Instruction Annulled (output)

This signal is asserted when the delay instruction is annulled (See. delayed control transfer). This signal is used to trace the IU execution pipe.

5.4 Interrupt, Clock, UART, GPI, Timer, TAP and Test Signals

■ RTC – Real-time Clock Counter Output (output)

This signal is generated when the delay time has elapsed in the 'Real-time Clock Timer'. This output is asserted high for 1.5 SYSCLK period.

■ RXA – Receive Data channel A (input)

RXA is the serial data input for channel A of the UART.

■ RXB – Receive Data channel B (input)

RXB is the serial data input for channel B of the UART.

■ TXA – Transmit Data channel A (output)

TXA is the serial data output for channel A of the UART.

■ TXB – Transmit Data channel B (output)

TXB is the serial data output for channel B of the UART.

■ GPI[7:0] – General-purpose Interface (input/output)

Each pin of the GPI is programmable as input or output.

■ GPIINT – General-purpose Interface Interrupt (output)

An edge detection (rising or falling) is made on each GPI input pin configured as input. GPIINT is the result of a logical OR of these detections. This output is asserted high for 2 SYSCLK periods.

■ EXTINT[4:0] – External Interrupt (input)

The five external interrupt inputs are programmable to be level or edge sensitive, and active high (rising) or active low (falling).

■ EXTINTACK – External Interrupt Acknowledge (output)

EXTINTACK is used for giving acknowledge to an interrupting unit which requires such a signal. It is programmable for the five external interrupt inputs it is associated. It is issued as soon as the IU has recognized the interrupt.

■ IWDE – Internal Watchdog Enable (input)

This static signal commands the multiplexer placed in front of the Watchdog timeout interrupt of the 'Interrupt Pending Register'. To use the internal Watchdog, IWDE must set to high. This input set to low enables the input EWDINT for an external Watchdog and disables entirely the internal Watchdog (not running). The value of IWDE is copied into the 'System Control Register' bit-15.

5-108 TSC695F User Manual

Microchip TSC695F - Interrupt, Clock, UART, GPI, Timer, TAP and Test Signals - 1

■ EWDINT – External Watchdog Interrupt (input)

This input enabled by IWDE receives an external Watchdog timeout. Another usage of this input can be an NMI. This input must asserted high for a minimum of 2 SYSCLK periods.

■ WDCLK – Watchdog Clock (input)

WDCLK is the WD clock input but this clock can also be used as a clock input for the UART interface. The clock frequency of WDCLK must be less than the clock frequency of SYSCLK, i.e., f_WDCLK < f_SYSCLK .

■ CLK2 – Double Frequency Clock (input)

CLK2 is the input clock to the TSC695F. The frequency of this clock must be twice the clock frequency f_SYSCLK used to drive the IU and the FPU. Note that some external timings of the TSC695F can be affected by the duty cycle of CLK2.

■ SYSCLK – System Clock (output)

SYSCLK is a nominally 50% duty-cycle clock generated by the TSC695F from CLK2 and is used for clocking the IU and the FPU as well as other system logic. Note that the timing of the TSC695F is referenced by SYSCLK.

■ RESET (RESET*) - Reset (output)

RESET (RESET*) will be asserted when the TSC695F is to be synchronously reset. This occurs when either SYSRESET (SYSRESET*) is asserted or the TSC695F initiate a reset due to an error or a programming command. The minimum pulse width of RESET (RESET*) is 1024 SYSCLK periods to authorize the implementation of Flash memories in the application.

■ SYSRESET (SYSRESET*) – System Reset (input)

Assertion of this pin will reset the TSC695F. Following this assertion, RESET (RESET*) is generated for a minimum of 1024 SYSCLK periods. SYSRESET* must be asserted for a minimum of 4 SYSCLK periods.

■ TMODE[1:0] – Test mode (input)

This test mode is only dedicated for factory test mode. The user functional mode is: TMODE[1:0] = '00'.

■ DEBUG – Software Debug mode (input)

DEBUG directly enables the setting of halt bits of the 'Timer Control Register' to freeze integrated peripherals.

DEBUG + phlt freeze the internal Watchdog and the 2 internal timers,

DEBUG + phlt + ahlt freeze the channel A of the internal UART,

DEBUG + phlt + bhlt freeze the channel B of the internal UART.

For final application, this pin must be grounded. This allows to keep software included debug facilities.

■ TCK – Test Clock (input)

Test clock for scan registers.

■ (TRST*) - Test Reset (input)

Asynchronous reset for the TAP controller. For final application, this pin must be grounded.

■ TMS – Test Mode Select (input)

Selects test mode of the TAP controller.

■ TDI – Test Data Input (input)

Test scan register data input.

■ TDO – Test Data Output (output)

Test scan register data output.

5.5 Power Signals

■ VCCO, VCCI – Power

VCCO pins supply the output and bidirectional pins of the TSC695F.

VCCI pins supply the input and the main internal circuitry of the TSC695F.

■ VSSO, VSSI – Ground

VSSO pins provide ground return for the output and bidirectional pins of the TSC695F. VSSI pins provide ground return for the input and the main internal circuitry of the TSC695F.

5.6 Document History

RevisionPurpose of Modifications Date
4148G Reference release 07/2002
4148H Section 3.6.7 TrapsImprovement of Comments on Table 3-4Improvement of Priority specificationAddition of SYSFSR update informationAddition of FAILAR update informationSection 4.11 Configuration RegistersSYFSR register description12/2003

Atmel Corporation Atmel Operations

2325 Orchard Parkway

San Jose, CA 95131, USA

Tel: 1(408) 441-0311

Fax: 1(408) 487-2600

Regional Headquarters

Europe

Atmel Sarl

77 Mody Road Tsimshatsui

East Kowloon

Hong Kong

Tel: (852) 2721-9778

Fax: (852) 2722-1369

Japan

9F, Tonetsu Shinkawa Bldg.

1-24-8 Shinkawa

Chuo-ku, Tokyo 104-0033

Japan

Tel: (81) 3-3523-3551

Fax: (81) 3-3523-7581

Memory

2325 Orchard Parkway

San Jose, CA 95131, USA

Tel: 1(408) 441-0311

Fax: 1(408) 436-4314

Microcontrollers

2325 Orchard Parkway

San Jose, CA 95131, USA

Tel: 1(408) 441-0311

Fax: 1(408) 436-4314

La Chantrerie

BP 70602

44306 Nantes Cedex 3, France

Tel: (33) 2-40-18-18-18

Fax: (33) 2-40-18-19-60

ASIC/ASSP/Smart Cards

Zone Industrielle

13106 Rousset Cedex, France

Tel: (33) 4-42-53-60-00

Fax: (33) 4-42-53-60-01

1150 East Cheyenne Mtn. Blvd.

Colorado Springs, CO 80906, USA

Tel: 1(719) 576-3300

Fax: 1(719) 540-1759

Scottish Enterprise Technology Park

Maxwell Building

East Kilbride G75 0QR, Scotland

Tel: (44) 1355-803-000

Fax: (44) 1355-242-743

RF/Automotive

Theresienstrasse 2

Postfach 3535

74025 Heilbronn, Germany

Tel: (49) 71-31-67-0

Fax: (49) 71-31-67-2340

1150 East Cheyenne Mtn. Blvd.

Colorado Springs, CO 80906, USA

Tel: 1(719) 576-3300

Fax: 1(719) 540-1759

Biometrics/Imaging/Hi-Rel MPU/

High Speed Converters/RF Datacom

Avenue de Rochepleine

BP 123

38521 Saint-Egreve Cedex, France

Tel: (33) 4-76-58-30-00

Fax: (33) 4-76-58-34-80

Literature Requests

www.atmel.com/literature

Disclaimer: Atmel Corporation makes no warranty for the use of its products, other than those expressly contained in the Company's standard warranty which is detailed in Atmel's Terms and Conditions located on the Company's web site. The Company assumes no responsibility for any errors which may appear in this document, reserves the right to change devices or specifications detailed herein at any time without notice, and does not make any commitment to update the information contained herein. No licenses to patents or other intellectual property of Atmel are granted by the Company in connection with the sale of Atmel products, expressly or by implication. Atmel's products are not authorized for use as critical components in life support devices or systems.

© Atmel Corporation 2003. All rights reserved. Atmel ^® and combinations thereof are the trademarks of Atmel Corporation or its subsidiaries. Other terms and product names may be the trademarks of others.

Microchip TSC695F - High Speed Converters/RF Datacom - 1

Printed on recycled paper.

4148H-AERO-12/03/xM

Table of contents Click a title to access it
Manual assistant
Powered by Anthropic
Waiting for your message
Product information

Brand : Microchip

Model : TSC695F

Category : Electronic component