GIGABYTE

G493-ZB2 - Server GIGABYTE - Free user manual and instructions

Find the device manual for free G493-ZB2 GIGABYTE in PDF.

📄 163 pages English EN Download 💬 AI Question
Notice GIGABYTE G493-ZB2 - page 2
Pick your language and provide your email: we'll send you a specifically translated version.

User questions about G493-ZB2 GIGABYTE

0 question about this device. Answer the ones you know or ask your own.

Ask a new question about this device

The email remains private: it is only used to notify you if someone responds to your question.

No questions yet. Be the first to ask one.

Download the instructions for your Server in PDF format for free! Find your manual G493-ZB2 - GIGABYTE and take your electronic device back in hand. On this page are published all the documents necessary for the use of your device. G493-ZB2 by GIGABYTE.

USER MANUAL G493-ZB2 GIGABYTE

© 2023 Giga Computing Technology CO., LTD. All rights reserved.

The trademarks mentioned in this manual are legally registered to their respective owners.

Disclaimer

Information in this manual is protected by copyright laws and is the property of Giga Computing. Changes to the specifications and features in this manual may be made by Giga Computing without prior notice. No part of this manual may be reproduced, copied, translated, transmitted, or published in any form or by any means without Giga Computing's prior written permission.

Documentation Classifications

In order to assist in the use of this product, Giga Computing provides the following types of documentation:

■ User Manual: detailed information & steps about the installation, configuration and use of this product (e.g. motherboard, server barebones), covering hardware and BIOS.
■ User Guide: detailed information about the installation & use of an add-on hardware or software component (e.g. BMC firmware, rail-kit) compatible with this product.
■ Quick Installation Guide: a short guide with visual diagrams that you can reference easily for installation purposes of this product (e.g. motherboard, server barebones).

Please see the support section of the online product page to check the current availability of these documents.

For More Information

For related product specifications, the latest firmware and software, and other information please visit our website at http://www.gigabyte.com/Enterprise

For GIGABYTE distributors and resellers, additional sales & marketing materials are available from our reseller portal: http://reseller.b2b.gigabyte.com

For further technical assistance, please contact your GIGABYTE representative or visit https://esupport.gigabyte.com/ to create a new support ticket

For any general sales or marketing enquiries, you may also message GIGABYTE server directly by email: server.grp@gigabyte.com

Conventions

The following conventions are used in this user's guide:

GIGABYTE G493-ZB2 - Conventions - 1NOTE!Gives bits and pieces of additional information related to the current topic.
GIGABYTE G493-ZB2 - Conventions - 2CAUTION!Gives precautionary measures to avoid possible hardware or software problems.
GIGABYTE G493-ZB2 - Conventions - 3WARNING!Alerts you to any damage that might result from doing or not doing specific actions.

Server Warnings and Cautions

Before installing a server, be sure that you understand the following warnings and cautions.

GIGABYTE G493-ZB2 - Server Warnings and Cautions - 1

WARNING!

To reduce the risk of electric shock or damage to the equipment:

  • Do not disable the power cord grounding plug. The grounding plug is an important safety feature.
  • Plug the power cord into a grounded (earthed) electrical outlet that is easily accessible at all times.
  • Unplug all the power cords from the power supplies to disconnect power to the equipment.

GIGABYTE G493-ZB2 - To reduce the risk of electric shock or damage to the equipment: - 1

GIGABYTE G493-ZB2 - To reduce the risk of electric shock or damage to the equipment: - 2

  • Shock Hazard! Disconnect all power supply cords before servicing.
  • Do not route the power cord where it can be walked on or pinched by items placed against it. Pay particular attention to the plug, electrical outlet, and the point where the cord extends from the server.

GIGABYTE G493-ZB2 - To reduce the risk of electric shock or damage to the equipment: - 3

WARNING!

To reduce the risk of personal injury from hot surfaces, allow the drives and the internal system components to cool before touching them.

GIGABYTE G493-ZB2 - WARNING! - 1

WARNING!

This server is equipped with high speed fans. Keep away from hazardous moving fan blades during servicing.

GIGABYTE G493-ZB2 - WARNING! - 1

WARNING!

This equipment is intended to be used in Restrict Access Location. The access can only be gained by Skilled person.

Only authorized by well trained professional person can access the restrict access location.

GIGABYTE G493-ZB2 - WARNING! - 1

CAUTION!

  • Do not operate the server for long periods with the access panel open or removed. Operating the server in this manner results in improper airflow and improper cooling that can lead to thermal damage.
  • Danger of explosion if battery is incorrectly replaced.
  • Replace only with the same or equivalent type recommended by the manufacturer.
  • Dispose of used batteries according to the manufacturer's instructions.

Electrostatic Discharge (ESD)

GIGABYTE G493-ZB2 - Electrostatic Discharge (ESD) - 1

CAUTION!

ESD CAN DAMAGE DRIVES, BOARDS, AND OTHER PARTS. WE RECOMMEND THAT YOU PERFORM ALL PROCEDURES AT AN ESD WORKSTATION. IF ONE IS NOT AVAILABLE, PROVIDE SOME ESD PROTECTION BY WEARING AN ANTI-STATIC WRIST STRAP ATTACHED TO CHASSIS GROUND -- ANY UNPAINTED METAL SURFACE -- ON YOUR SERVER WHEN HANDLING PARTS.

Always handle boards carefully. They can be extremely sensitive to ESD. Hold boards only by their edges without any component and pin touching. After removing a board from its protective wrapper or from the system, place the board component side up on a grounded, static free surface. Use a conductive foam pad if available but not the board wrapper. Do not slide board over any surface.

System power on/off: To remove power from system, you must remove the system from rack. Make sure the system is removed from the rack before opening the chassis, adding, or removing any non hot-plug components.

Hazardous conditions, devices and cables: Hazardous electrical conditions may be present on power, telephone, and communication cables. Turn off the system and disconnect the cables attached to the system before servicing it. Otherwise, personal injury or equipment damage can result.

Electrostatic discharge (ESD) and ESD protection: ESD can damage drives, boards, and other parts. We recommend that you perform all procedures in this chapter only at an ESD workstation. If one is not available, provide some ESD protection by wearing an antistatic wrist strap attached to chassis ground (any unpainted metal surface on the server) when handling parts.

ESD and handling boards: Always handle boards carefully. They can be extremely sensitive to electrostatic discharge (ESD). Hold boards only by their edges. After removing a board from its protective wrapper or from the system, place the board component side up on a grounded, static free surface. Use a conductive foam pad if available but not the board wrapper. Do not slide board over any surface.

Installing or removing jumpers: A jumper is a small plastic encased conductor that slips over two jumper pins. Some jumpers have a small tab on top that can be gripped with fin-gertips or with a pair of fine needle nosed pliers. If the jumpers do not have such a tab, take care when using needle nosed pliers to remove or install a jumper; grip the narrow sides of the jumper with the pliers, never the wide sides. Gripping the wide sides can dam-age the contacts inside the jumper, causing intermittent problems with the function controlled by that jumper. Take care to grip with, but not squeeze, the pliers or other tool used to remove a jumper, or the pins on the board may bend or break.

GIGABYTE G493-ZB2 - CAUTION! - 1

CAUTION!

Risk of explosion if battery is replaced incorrectly or with an incorrect type. Replace the battery only with the same or equivalent type recommended by the manufacturer. Dispose of used batteries according to the manufacturer's instructions.

Table of Contents

Chapter 1 Hardware Installation ....10

1-1 Installation Precautions.... 10
1-2 Product Specifications.... 11
1-3 System Block Diagram.... 15

Chapter 2 System Appearance....16

2-1 Front View 16
2-2 Rear View....16
2-3 Front Panel LED and Buttons 17

2-3-1 RoT LEDs....18

2-4 Front Panel System LAN LEDs....20
2-5 Power Supply Unit (PSU) LED 21
2-6 Hard Disk Drive LEDs 22

Chapter 3 System Hardware Installation ......23

3-1 Removing and Installing the Chassis Top Cover....24
3-2 Installing the GPU Card 25
3-3 Installing the PCI Expansion Card 26
3-4 Moving the Front HDD Cage....28
3-5 Removing and Installing the Heat Sink 29
3-6 Installing the CPU 31
3-7 Installing the Memory 32

3-7-1 Twelve Channel Memory Configuration....32
3-7-2 Installing the Memory 33
3-7-3 Processor and Memory Module Matrix Table 33
3-7-4 DIMM Population Table 34

3-8 Installing the Hard Disk Drive 35
3-9 Installing the M.2 Device and Heat Sink 36
3-10 Replacing the System Fan Module 37
3-11 Removing and Installing the Power Supply.... 38
3-12 Cable Connection....39

3-12-1 Motherboard to PCIe Board and Front Side Low-Profile Card Cable....39
3-12-2 PCIe Board to Rear Top PCIe Card Cable 41
3-12-3 Motherboard to HDD Backplane Board and PCIe Board 42

Chapter 4 Motherboard Components ....44

4-1 Motherboard Components 44

4-2 Jumper Setting 46

4-3 G-SC Module 47

4-3-1 CDCG110 47

4-4 Backplane Board Storage Connector 48

4-4-1 CBP10C2....48

Chapter 5 BIOS Setup ....49

5-1 The Main Menu 51

5-2 Advanced Menu 54

5-2-1 Trusted Computing....55

5-2-2 PSP Firmware Versions....56

5-2-3 Legacy Video Select....57

5-2-4 AST2600 Super IO Configuration....58

5-2-5 S5 RTC Wake Settings....60

5-2-6 Serial Port Console Redirection 61

5-2-7 CPU Configuration....65

5-2-8 PCI Subsystem Settings....66

5-2-9 USB Configuration....68

5-2-10 Network Stack Configuration....70

5-2-11 NVMe Configuration....71

5-2-12 SATA Configuration....72

5-2-13 Graphic Output Configuration....73

5-2-14 AMD Mem Configuration Status....74

5-2-15 Tls Auth Configuration....75

5-2-16 RAM Disk Configuration....76

5-2-17 iSCSI Configuration....77

5-2-18 Intel(R) I350 Gigabit Network Connection....78

5-2-19 VLAN Configuration....80

5-2-20 MAC IPv4 Network Configuration....81

5-2-21 MAC IPv6 Network Configuration....82

5-3 AMD CBS Menu....83

5-3-1 CPU Common Options....84

5-3-2 DF Common Options....90

5-3-3 UMC Common Options 97

5-3-4 NBIO Common Options....118

5-3-5 FCH Common Options....129

5-3-6 SOC Miscellaneous Control 138

5-3-7 Workload Tuning....140

5-3-8 CXL Common Options....141

5-4 AMD PBS Menu....142

5-4-1 RAS 143

5-5 Chipset Setup Menu....145

5-5-1 North Bridge 146

5-5-2 Fabric Resource 147

5-6 Server Management Menu....149

5-6-1 System Event Log 151

5-6-2 View FRU Information 152

5-6-3 BMC Network Configuration....153

5-6-4 IPv6 BMC Network Configuration....154

5-7 Security Menu 155

5-7-1 Secure Boot 156

5-8 Boot Menu....159

5-9 Save & Exit Menu....161

5-10 BIOS Recovery 162

5-11 BIOS POST Beep code (AMI standard).... 163

5-11-1 PEI Beep Codes....163

5-11-2 DXE Beep Codes 163

Chapter 1 Hardware Installation

1-1 Installation Precautions

The motherboard/system contain numerous delicate electronic circuits and components which can become damaged as a result of electrostatic discharge (ESD). Prior to installation, carefully read the user manual and follow these procedures:

  • Prior to installation, do not remove or break motherboard S/N (Serial Number) sticker or warranty sticker provided by your dealer. These stickers are required for warranty validation.
  • Always remove the AC power by unplugging the power cord from the power outlet before installing or removing the motherboard or other hardware components.
  • When connecting hardware components to the internal connectors on the motherboard, make sure they are connected tightly and securely.

- When handling the motherboard, avoid touching any metal leads or connectors.

- It is best to wear an electrostatic discharge (ESD) wrist strap when handling electronic components such as a motherboard, CPU or memory. If you do not have an ESD wrist strap, keep your hands dry and first touch a metal object to eliminate static electricity.

- Prior to installing the motherboard, please have it on top of an antistatic pad or within an electrostatic shielding container.

- Before unplugging the power supply cable from the motherboard, make sure the power supply has been turned off.

- Before turning on the power, make sure the power supply voltage has been set according to the local voltage standard.

- Before using the product, please verify that all cables and power connectors of your hardware components are connected.

- To prevent damage to the motherboard, do not allow screws to come in contact with the motherboard circuit or its components.

- Make sure there are no leftover screws or metal components placed on the motherboard or within the computer casing.

- Do not place the computer system on an uneven surface.

- Do not place the computer system in a high-temperature environment.

- Turning on the computer power during the installation process can lead to damage to system components as well as physical harm to the user.

- If you are uncertain about any installation steps or have a problem related to the use of the product, please consult a certified computer technician.

1-2 Product Specifications

GIGABYTE G493-ZB2 - 1-2 Product Specifications - 1

NOTE:

We reserve the right to make any changes to the product specifications and product-related information without prior notice.

GIGABYTE G493-ZB2 - NOTE: - 1System◆ 4U
Dimension◆ 448 x 176 x 880 (W x H x D, mm)
GIGABYTE G493-ZB2 - NOTE: - 2CPU ◆ AMD EPYCTM 9004 series processors
◆ AMD EPYCTM 9004 series processors with AMD 3D V-CacheTM Technology
◆ Dual processor, 5nm technology
◆ *Up to 128-core, 256 threads per processor
◆ cTDP up to 300W at ambient 35°C
*cTDP supported up to 400W under limited thermal conditions. Please contact technical support for more details.
NOTE: If only 1 CPU is installed, some PCIe or memory functions might be unavailable
GIGABYTE G493-ZB2 - NOTE: - 3Socket ◆ 2 x LGA 6096
◆ Socket SP5
GIGABYTE G493-ZB2 - NOTE: - 4Chipset◆ System on Chip
GIGABYTE G493-ZB2 - NOTE: - 5Security ◆ UEFI Secure Boot
◆ Silicon root of trust (Option)
◆ SNMP Support: V3
GIGABYTE G493-ZB2 - NOTE: - 6Memory ◆ 48 x DIMM slots
◆ DDR5 memory supported only
◆ 12-Channel memory architecture per processor
◆ RDIMM modules up to 96GB supported
◆ 3DS RDIMM modules up to 256GB supported
◆ Memory speed: Up to 4800 MHz (1DPC), 3600 MHz (2DPC)
GIGABYTE G493-ZB2 - NOTE: - 7LAN Front Side:
◆ 2 x 1Gb/s BASE-T LAN ports (1 x Intel® I350-AM2)
◆ NCSI function supported
◆ 1 x 10/100/1000 management LAN
GIGABYTE G493-ZB2 - NOTE: - 8Video◆ Integrated in Aspeed® AST2600
◆ 2D Video Graphic Adapter with PCIe bus interface
◆ 1920x1200@60Hz 32bpp, DDR4 SDRAM
GIGABYTE G493-ZB2 - NOTE: - 9Storage ◆ 12 x 2.5" NVMe/SATA/SAS hot-swappable bays
- (2 x from CPU_0, 2 x from CPU_1, 4 x from PEX_0, 4 x from PEX_1)
SAS card is required for SAS devices support

GIGABYTE G493-ZB2 - NOTE: - 10

Expansion Slot ♦ 8 x PCIe x16 slots (Gen5 x16 bus) for GPUs

- (4 x from PEX_0, 4 x from PEX_1)

◆ 4 x FHFL PCIe x16 slots (Gen5 x16 bus)

- (2 x from PEX_0, 2 x from PEX_1)

◆ 2 x Low profile PCIe Gen5 x16 MD2 expansion slots on front side

- (1 x from CPU_0, 1 x from CPU_1)

- System is validated for population with a uniform GPU model

- Support is not provided for mixed GPU populations

◆ 2 x M.2 slot:

- M-key

- PCIe Gen3 x4 from CPU_0

- PCIe Gen3 x4 from CPU_1

- Supports 2280/ 22110 cards

GIGABYTE G493-ZB2 - NOTE: - 11

Internal I/O

◆ 1 x TPM header

GIGABYTE G493-ZB2 - NOTE: - 12

Front I/O ♦ 2 x USB 3.2 Gen1

◆ 1 x VGA

◆ 2 x RJ45

◆ 1 x MLAN

◆ 1 x Power button with LED

◆ 1 x ID button with LED

◆ 1 x Reset button

◆ 1 x NMI button

◆ 1 x System status LED

◆ 1 x HDD access LED

GIGABYTE G493-ZB2 - NOTE: - 13

Rear I/O

N/A

GIGABYTE G493-ZB2 - NOTE: - 14

Backplane I/O

◆ Backplane P/N: 9CBP10C2NR-00

◆ Speed and bandwidth: PCIe Gen5 x4 or SATA 6Gb/s or SAS 12Gb/s

GIGABYTE G493-ZB2 - NOTE: - 15

TPM ♦ 1 x TPM header with SPI interface

♦ Optional TPM2.0 kit: CTM010

GIGABYTE G493-ZB2 - NOTE: - 16

Power Supply

◆ 3+1 3000W (240V) 80 PLUS Titanium redundant power supply

AC Input:

- 100-127V\~/ 15.5A, 50-60Hz

- 200-220V\~/ 15.5A, 50-60Hz

- 220-240V\~/ 15.5A, 50-60Hz

DC Input:

- 240Vdc/ 15.5A

DC Output:

- Max 1000W/ 100-127V\~

+ 12.2V/81A

+ 12Vsb/ 3A

- Max 2600W/ 200-220V\~

+ 12.2V/ 213A

+ 12Vsb/ 3A

- Max 3000W/ 220-240V\~

+ 12.2V/ 240A

+ 12Vsb/ 3A

NOTE:

- The system power supply requires C19 type power cord

The power supply specifications provided herein is for the default server configuration. Different SKUs have different PSU specs, so please see the system rating label on the server for the accurate PSU specification.

GIGABYTE G493-ZB2 - NOTE: - 1System ManagementAspeed® AST2600 management controllerGIGABYTE Management Console (AMI MegaRAC SP-X) web interface
◆ Dashboard◆ HTML5 KVM◆ Sensor Monitor (Voltage, RPM, Temperature, CPU Status ...etc.)◆ Sensor Reading History Data◆ FRU Information◆ SEL Log in Linear Storage / Circular Storage Policy◆ Hardware Inventory◆ Fan Profile◆ System Firewall◆ Power Consumption◆ Power Control◆ LDAP / AD / RADIUS Support◆ Backup & Restore Configuration◆ Remote BIOS/BMC/CPLD Update◆ Event Log Filter◆ User Management◆ Media Redirection Settings◆ PAM Order Settings◆ SSL Settings◆ SMTP Settings
GIGABYTE G493-ZB2 - NOTE: - 2System Fans◆ 6 x 60x60x38mm (23,000rpm)
GIGABYTE G493-ZB2 - NOTE: - 3Operating Properties◆ Operating temperature: 10°C to 35°C◆ Operating humidity: 8-80% (non-condensing)◆ Non-operating temperature: -40°C to 60°C◆ Non-operating humidity: 20%-95% (non-condensing)

1-3 System Block Diagram

GIGABYTE G493-ZB2 - 1-3 System Block Diagram - 1

flowchart
graph TD
    subgraph S-SC Module
        A["MLAN"] --> B["10/100/16 PHY(1ch)"]
        C["VGA"] --> D["2 x 1Gb/s BASE-T LAN"]
        E["Intel I350-AM2"] --> F["2 x USB 3.2 Gen1"]
        G["ASPEED AST2600"] --> H["BMC"]
        I["PCIe 2.0 x1"] --> J["CPU0 AMDA EPYC AMD EPYCTM 9004 Socket SP5"]
        K["USB2.0 x1"] --> L["PCIe 5.0 x16"]
        M["SPI Flash 128MB"] --> N["PCIe 3.0 x4"]
        O["SPI Flash 128MB"] --> P["PCIe 5.0 x8"]
        Q["SPI Flash 32MB"] --> R["PCIe 5.0 x8"]
        S["SPI Flash 32MB"] --> T["PCIe 5.0 x8"]
        U["TPM"] --> V["PCIe 3.0 x4"]
        W["PCIe Mur"] --> X["PCIe 5.0 x8"]
        Y["SATAIII x8"] --> Z["PCIe 5.0 x8"]
        AA["SATAIII x8"] --> AB["PCIe 5.0 x8"]
        AC["PCIe 5.0 x16"] --> AD["12 x 2.5" NVMe/SATA hot-swap bays"]
        AE["PCIe 5.0 x16"] --> AF["12-Channel DDR5, 24 x DIMMs Speed up to 4800 MHz (1DPC) 3600 MHz (2DPC)"]
        AG["PCIe 5.0 x16"] --> AH["PCIe 5.0 x16"]
        AI["PCIe 5.0 x16"] --> AJ["PCIe 5.0 x16"]
        AK["PCIe 5.0 x16"] --> AL["PCIe 5.0 x16"]
        AM["PCIe 5.0 x16"] --> AN["PCIe 5.0 x16"]
        AO["PCIe 5.0 x16"] --> AP["PCIe 5.0 x16"]
        AQ["PCIe 5.0 x16"] --> AR["PCIe 5.0 x16"]
        AS["PCIe 5.0 x16"] --> AT["PCIe 5.0 x16"]
        AU["PCIe 5.0 x16"] --> AV["PCIe 5.0 x16"]
        AW["PCIe 5.0 x16"] --> AX["PCIe 5.0 x16"]
        AY["PCIe 5.0 x16"] --> AZ["PCIe 5.0 x16"]
        BA["PCIe 5.0 x16"] --> BB["PCIe 5.0 x16"]
        BC["PCIe 5.0 x16"] --> BD["PCIe 5.0 x16"]
        BE["PCIe 5.0 x16"] --> BF["PCIe 5.0 x16"]
        BG["PCIe 5.0 x16"] --> BH["PCIe 5.0 x16"]
        BI["PCIe 5.0 x16"] --> BJ["PCIe 5.0 x16"]
        BK["PCIe 5.0 x16"] --> BL["PCIe 5.0 x16"]
        BM["PCIe 5.0 x16"] --> BN["PCIe 5.0 x16"]
        BO["PCIe 5.0 x16"] --> BP["PCIe 5.0 x16"]
        BQ["PCIe 5.0 x16"] --> BR["PCIe 5.0 x16"]
        BS["PCIe 5.0 x16"] --> BT["PCIe 5.0 x16"]
        BU["PCIe 5.0 x16"] --> BV["PCIe 5.0 x16"]
        BW["PCIe 5.0 x16"] --> BX["PCIe 5.0 x16"]
        BY["PCIe 5.0 x16"] --> BZ["PCIe 5.0 x16"]
        CA["PCIe 5.0 x16"] --> CB["PCIe 5.0 x16"]
        CC["PCIe 5.0 x16"] --> CD["PCIe 5.0 x16"]
        DE["PCIe 5.0 x16"] --> FD["PCIe 5.0 x16"]
        DG["PCIe 5.0 x16"] --> DH["PCIe 5.0 x16"]
        DI["PCIe 5.0 x16"] --> DJ["PCIe 5.0 x16"]
        DK["PCIe 5.0 x16"] --> DL["PCIe 5.0 x16"]
        DM["PCIe 5.0 x16"] --> DN["PCIe 5.0 x16"]
        DOX["PCIe 5.0 x16"] --> DY["PCIe 5.0 x16"]
        DX["XGMB332GT/s x16"] <--> DC
    end
    S-PM --> CPU
    T-PM --> CPU
    U-PM --> CPU
    V-PM --> CPU
    W-PM --> CPU
    X-PM --> CPU
    Y-PM --> CPU
    Z-PM --> CPU
    AA-PM --> CPU
    AB-PM --> CPU
    AC-PM --> CPU
    AD-PM --> CPU
    AE-PM --> CPU
    AF-PM --> CPU
    AG-PM --> CPU
    AH-PM --> CPU
    AI-PM --> CPU
    AJ-PM --> CPU
    AK-PM --> CPU
    AL-PM --> CPU
    AM-PM --> CPU
    AN-PM --> CPU
    AO-PM --> CPU
    AP-PM --> CPU
    AQ-PM --> CPU
    AR-PM --> CPU
    AS-PM --> CPU
    AT-PM --> CPU
    AU-PM --> CPU
    AV-PM --> CPU
    AW - CPU --> CPU
    AX - CPU --> CPU
    AY - CPU --> CPU
    AZ - CPU --> CPU
    BA - CPU --> CPU
    BB - CPU --> CPU
    BC - CPU --> CPU
    BD - CPU --> CPU
    BE - CPU --> CPU
    BF - CPU --> CPU
    BG - CPU --> CPU
    BH - CPU --> CPU
    BI - CPU --> CPU
    BJ - CPU --> CPU
    BK - CPU --> CPU
    BL - CPU --> CPU
    BM - CPU --> CPU
    BN - CPU --> CPU

Chapter 2 System Appearance

2-1 Front View

GIGABYTE G493-ZB2 - 2-1 Front View - 1

text_image Diagram of a rack-mounted server or network device with labeled ports and internal components
No.Description
1.PCIe Slot
2.PCIe Slot
3.1GbE LAN Port x 2
4.Front Panel LEDs and Buttons
5.VGA Port
6.GPU Tray
7.USB 3.2 Gen1 Port x 2
NOTE! Drives with green latches support NVMe.

GIGABYTE G493-ZB2 - 2-1 Front View - 2

- Go to the section 2-3 Front Panel Buttons and LEDs for detail description of function LEDs.

2-2 Rear View

GIGABYTE G493-ZB2 - 2-2 Rear View - 1

text_image PSU4 PSU3 PSU2 PSU1 SLOT10 SLOT11S SLOT9 SLOT8 SLOT7 SLOT6 SLOT5 SLOT4 SLOT3 SLOT2 SLOT1 1

No. Description

  1. PCIe x16 Slot x12

2-3 Front Panel LED and Buttons

GIGABYTE G493-ZB2 - 2-3 Front Panel LED and Buttons - 1

text_image 1 RST HDD NMI SYS 2 3 5 Power ID 4 6
No.NameColorStatusDescription
1.Reset Button Press the button to reset the system.
2.NMI buttonPress the button server generates a NMI to the processor if the multiple-bit ECC errors occur, which effectively halt the server.
3.HDD Status LEDGreenOn HDD locate
Blink HDD access
Amber On HDD fault
Green/ AmberBlink HDD rebuilding
N/A Off No HDD access or no HDD fault.
4.System Status LED (Note)Green Solid On System is operating normally.
AmberSolid OnCritical condition, may indicate: System fan failure System temperature
BlinkNon-critical condition, may indicate: Redundant power module failure Temperature and voltage issue Chassis intrusion
N/A OffSystem is not ready, may indicate: POST error NMI error Processor or terminator missing
5.Power button with LEDGreen On System is powered on
Green Blink System is in ACPI S1 state (sleep mode)
N/A Off· System is not powered on or in ACPI S5 state (power off) · System is in ACPI S4 state (hibernate mode)
6.ID Button (Note)Press the button to activate system identification

(Note) If your server features RoT function, please see the following section for detail LED behavior.

2-3-1 RoT LEDs

GIGABYTE G493-ZB2 - 2-3-1 RoT LEDs - 1

text_image RST HDD NMI SYS Status LED ID LED
LED on Front panel ^(Note5)
ID LED Status LED
EC Firmware (FW) Authentication fail or not exit
EC FW is broken or not exit ^(Note1) OFF OFF
Authenticating/Recovering BMC/BIOS Images
Authenticating ImagesOFF OFF
Recovering BMC Active FlashBlinks Blue4 times persecondBlinks Green4 times persecond
Recovering BIOS Active FlashBlinks Blue4 times persecondBlinks Green4 times persecond
Authentication (AUTH) Pass
Recovering BIOS Active FlashOFF OFF
BMC : AUTH pass after doing recoveryBIOS : AUTH pass after doing recoveryOFF OFF
BMC : AUTH pass after doing recoveryBIOS : AUTH passOFF OFF
BMC : AUTH passBIOS : AUTH pass after doing recoveryOFF OFF
Active Flash Authentication (AUTH) Fail
BMC : AUTH Fail ^(Note2) Blinks Blue1 time persecondBlinks Green1 time per second
BIOS : AUTH fail (Note2)Blinks Blue1 time per secondBlinks Amber1 time per second
BMC : AUTH fail after doing recovery (Note3)Blinks Blue2 times per second[ON OFF OFF]Blinks Green2 times per second[ON OFF OFF]
BIOS : AUTH fail after doing recovery (Note3)Blinks Blue2 times per second[ON OFF OFF]Blinks Amber2 times per second[ON OFF OFF]
Backup Flash Authentication Fail(Note4)
BMC : AUTH failBlinks Blue2 times per second[ON OFF ON OFF]Blinks Green2 times per second[ON OFF ON OFF]
BIOS : AUTH failBlinks Blue2 times per second[ON OFF ON OFF]Blinks Amber2 times per second[ON OFF ON OFF]

NOTE!

  1. EC FW is broken or not exited result in Microchip CEC1702 cannot load EC FW for authentication.
    2 (1) Authentication fail include below scenarios

Configuration table is missing or modified

Public key is missing or modified

Protected area or signature is modified

Flash empty

  1. If active flash is still authentication failed after recovery sequence, Microchip CEC1702 stop the process and showing LED behavior.
  2. If backup flash authentication is failed cause by configuration table, public key or protected area is broken. Microchip CEC1702 stop the process and showing LED behavior.
  3. Front panel LED is controlled by BMC or Microchip CEC1702. Once Microchip CEC1702 is working(Auth or recovery), the front panel LED is controlled by Microchip CEC1702 and vice versa.

2-4 Front Panel System LAN LEDs

GIGABYTE G493-ZB2 - 2-4 Front Panel System LAN LEDs - 1

text_image 1 2 M M RPT HDD ID 1 2 2 1 1 2 NDC MTB
No.NameColorStatusDescription
1.1GbE Speed LEDYellow On 1 Gbps data rate
Green On 100 Mbps data rate
N/A Off 10 Mbps data rate
2.1GbE Link / Activity LEDGreenOn Link between system and network or no access
Blink Data transmission or reception is occurring.
N/A Off No data transmission or reception is occurring.

2-5 Power Supply Unit (PSU) LED

GIGABYTE G493-ZB2 - 2-5 Power Supply Unit (PSU) LED - 1

NOTE!

The power supply may be vary based on the system configuration.

PSU LED
GIGABYTE G493-ZB2 - 2-5 Power Supply Unit (PSU) LED - 2

natural_image Technical line drawing of a mechanical or electrical component with mounting holes and internal circuitry (no text or symbols)
StateDescription
OFF No AC power to all power supplies
1Hz Green Blinking AC present / only standby on / Cold redundant mode
2Hz Green Blinking Power supply firmware updating mode
AmberAC cord unplugged or AC power lost; with a second power supply in parallel still with AC input power
Power supply critical event causing shut down: failure, OCP, OVP, fan failure and UVP
1Hz Amber BlinkingPower supply warning events where the power supply continues to operate: high temp, high power, high current and slow fan

2-6 Hard Disk Drive LEDs

GIGABYTE G493-ZB2 - 2-6 Hard Disk Drive LEDs - 1

text_image LED1 LED2
RAID SKULED1LocateHDD FaultRebuildingHDD AccessHDD Present (No Access)
No RAID configuration (via HBA)Disk LED(LED on Back Panel)Green ON(*1)OFFBLINK (*2)OFF
Amber OFFOFFOFFOFF
Removed HDD Slot(LED on Back Panel)ON(*1)Green OFF----
OFFAmber OFF----
RAID configuration (via HW RAID Card or SW RAID Card)Disk LEDGreenONOFFBLINK (*2)OFF
AmberOFFON(Low Speed: 2 Hz)OFFOFF
Removed HDD SlotGreenON(*1)OFF(*3)----
AmberOFFON(*3)----
LED 2HDD Present NoHDD
GreenONOFF

NOTE:

*1: Depends on HBA/Utility Spec.
*2: Blink cycle depends on HDD's activity signal.
*3: If HDD is pulled out during rebuilding, the disk status of this HDD is regarded as faulty.

Chapter 3 System Hardware Installation

GIGABYTE G493-ZB2 - Chapter 3 System Hardware Installation - 1

Pre-installation Instructions

Computer components and electronic circuit boards can be damaged by electrostatic discharge. Working on computers that are still connected to a power supply can be extremely dangerous. Follow the simple guidelines below to avoid damage to your computer or injury to yourself.

  • Always disconnect the computer from the power outlet whenever you are working inside the computer case.
  • If possible, wear a grounded wrist strap when you are working inside the computer case. Alternatively, discharge any static electricity by touching the bare metal system of the computer case, or the bare metal body of any other grounded appliance.
  • Hold electronic circuit boards by the edges only. Do not touch the components on the board unless it is necessary to do so. Do not flex or stress the circuit board.
  • Leave all components inside the static-proof packaging until you are ready to use the component for the installation.

3-1 Removing and Installing the Chassis Top Cover

GIGABYTE G493-ZB2 - 3-1 Removing and Installing the Chassis Top Cover - 1

Before you remove or install the system cover

- Make sure the system is not turned on or connected to AC power.

Follow these instructions to remove/install the chassis top cover:

  1. Push button to unlock the handle.
  2. Pull the grip handle to open the panel cover.
  3. Slide the cover towards the rear and remove the cover in the direction indicated.
  4. Follow steps 1-3 in reverse order to re-install the top cover

GIGABYTE G493-ZB2 - Follow these instructions to remove/install the chassis top cover: - 1

text_image Technical diagram of a device's internal structure with numbered annotations indicating components and directional arrows.

3-2 Installing the GPU Card

GIGABYTE G493-ZB2 - 3-2 Installing the GPU Card - 1

Before you install/remove the GPU card:

- Voltages can be present within the server whenever an AC power source is connected. This voltage is present even when the main power switch is in the off position. Ensure that the system is powered down and all power sources have been disconnected from the server prior to installing a GPU card. Make sure the system is not turned on or connected to AC power.

- Failure to observe these warnings could result in personal injury or damage to the equipment.

• The GPU cards need to be purchased.

GIGABYTE G493-ZB2 - 3-2 Installing the GPU Card - 2

Follow these instructions to install the GPU card:

  1. Pull out the thumbnail screw securing the GPU card cage in place.
  2. Flip over the GPU card cage in the direction indicated.
  3. Remove the two screws securing the GPU card slot covers in place and remove the GPU card slot covers.
  4. Insert the GPU card into the selected slot. Make sure the PCIe card is properly seated.
  5. Install the two screws to secure the GPU card in place.
  6. Reverse the previous steps to remove the GPU card.

GIGABYTE G493-ZB2 - Follow these instructions to install the GPU card: - 1

text_image Technical diagram of a server rack with labeled components and directional arrows indicating assembly steps

3-3 Installing the PCI Expansion Card

GIGABYTE G493-ZB2 - 3-3 Installing the PCI Expansion Card - 1

- Voltages can be present within the server whenever an AC power source is connected. This voltage is present even when the main power switch is in the off position. Ensure that the system is powered-down and all power sources have been disconnected from the server prior to installing a PCIe card.

Failure to observe these warnings could result in personal injury or damage to equipment.

GIGABYTE G493-ZB2 - 3-3 Installing the PCI Expansion Card - 2

- The PCIe riser assembly does not include a riser card or any cabling as standard. To install a PCIe card, a riser card must be installed.

Follow these instructions to install the PCIe card:

  1. Remove the three screws securing the PCIe card bracket in place.
  2. Lift the PCIe card bracket in the direction indicated.
  3. Remove the two screws securing the PCIe card slot covers and remove the PCIe slot covers.
  4. Insert the PCIe card into the selected slot. Make sure the PCIe card is properly seated.
  5. Install the two screws to secure the PCIe card in place.
  6. Install the three screws to secure the PCIe card bracket in place.
  7. Reverse the previous steps to remove the PCIe card.

GIGABYTE G493-ZB2 - Follow these instructions to install the PCIe card: - 1

text_image Technical diagram of a server rack with labeled components and directional arrows indicating assembly or movement.

GIGABYTE G493-ZB2 - Follow these instructions to install the PCIe card: - 2

text_image Technical diagram of a server rack with numbered components and labeled parts, showing signal flow and ventilation connections.

GIGABYTE G493-ZB2 - Follow these instructions to install the PCIe card: - 3

text_image Technical diagram of a server rack with numbered components and labeled parts

3-4 Moving the Front HDD Cage

GIGABYTE G493-ZB2 - 3-4 Moving the Front HDD Cage - 1

Before you move the front HDD cage:

- Make sure the system is not turned on or connected to AC power.

- Remove the chassis cover.

GIGABYTE G493-ZB2 - 3-4 Moving the Front HDD Cage - 2

- Before you remove or install the memory module, please move the HDD cage towards to front first.

Follow these instructions to move the front HDD Cage:

  1. Remove the four screws on both sides of the system.
  2. Loosen the thumbnail screw securing the HDD cage.
  3. Push the grip handle towards the front and move the HDD cage in the direction indicated.
  4. Reverse the previous steps to recover the HDD cage in place.

GIGABYTE G493-ZB2 - Follow these instructions to move the front HDD Cage: - 1

text_image Technical diagram of a server rack with labeled components and directional arrows indicating assembly or connection.

3-5 Removing and Installing the Heat Sink

GIGABYTE G493-ZB2 - 3-5 Removing and Installing the Heat Sink - 1

Read the following guidelines before you begin to remove/install the heat sink:

  • Always turn off the computer and unplug the power cord from the power outlet before installing the heat sink to prevent hardware damage.
  • Unplug all cables from the power outlets.
  • Disconnect all telecommunication cables from their ports.
  • Place the system unit on a flat and stable surface.
  • Open the system according to the instructions.

GIGABYTE G493-ZB2 - 3-5 Removing and Installing the Heat Sink - 2

WARNING!

Failure to turn off the server before you start installing components may cause serious damage. Do not attempt the procedures described in the following sections unless you are a qualified service technician.

Follow these instructions to remove/install the heat sink:

  1. Loosen the captive screws securing the heat sink in place in reverse order (6 →5→4→3→2→1).
  2. Lift and remove the heat sink from the system.
  3. To reinstall the heat sink reverse steps 1-2 while ensuring that you tighten the captive screws in sequential order (1→2→3→4→5→6) as seen in the image below.

GIGABYTE G493-ZB2 - Follow these instructions to remove/install the heat sink: - 1

text_image CPU0 CPU1

GIGABYTE G493-ZB2 - Follow these instructions to remove/install the heat sink: - 2

text_image CPU0 CPU1 XXX

GIGABYTE G493-ZB2 - Follow these instructions to remove/install the heat sink: - 3

text_image CPU0 CPU1

GIGABYTE G493-ZB2 - Follow these instructions to remove/install the heat sink: - 4

  • When installing the heat sink to CPU, use a Torx T20 screwdriver to tighten 6 captive nuts in sequence as 1-6. The screw tightening torque: 12.5-15.0 kgf-cm.
  • To ensure the system operates properly, make sure the heat sink is seated on the processor firmly.

3-6 Installing the CPU

GIGABYTE G493-ZB2 - 3-6 Installing the CPU - 1

Read the following guidelines before you begin to install the CPU:

  • Make sure that the motherboard supports the CPU.
  • Always turn off the computer and unplug the power cord from the power outlet before installing the CPU to prevent hardware damage.
  • Unplug all cables from the power outlets.
  • Disconnect all telecommunication cables from their ports.
  • Place the system unit on a flat and stable surface.
  • Open the system according to the instructions.

GIGABYTE G493-ZB2 - 3-6 Installing the CPU - 2

WARNING!

Failure to properly turn off the server before you start installing components may cause serious damage. Do not attempt the procedures described in the following sections unless you are a qualified service technician.

Follow these instructions to install the CPU:

  1. Loosen the captive screw securing the CPU cover.
  2. Flip open the CPU cover.
  3. Remove the CPU carrier from the CPU frame using the handle on the CPU carrier.
  4. Using the handle on the CPU carrier insert the new CPU carrier with CPU installed into the CPU frame.
    NOTE: Ensure the CPU is installed in the CPU carrier in the correct orientation, with the triangle on the CPU aligned to the top left corner of the CPU carrier.
  5. Flip the CPU frame with CPU installed into place in the CPU socket.
  6. Flip the CPU cover into place over the CPU socket.
  7. Tighten the CPU cover screw to secure the CPU cover in place.

GIGABYTE G493-ZB2 - Follow these instructions to install the CPU: - 1

flowchart
graph TD
    A["CPU"] --> B["External cap"]
    B --> C["CPU with CPU connection"]
    C --> D["CPU with external cap connection"]
    D --> E["CPU with external cap connection"]
    E --> F["CPU with external cap connection"]
    F --> G["CPU with external cap connection"]
    G --> H["CPU with external cap connection"]
    H --> I["CPU with external cap connection"]
    I --> J["CPU with external cap connection"]
    J --> K["CPU with external cap connection"]
    K --> L["CPU with external cap connection"]
    L --> M["CPU with external cap connection"]
    M --> N["CPU with external cap connection"]
    N --> O["CPU with external cap connection"]
    O --> P["CPU with external cap connection"]
    P --> Q["CPU with external cap connection"]
    Q --> R["CPU with external cap connection"]
    R --> S["CPU with external cap connection"]
    S --> T["CPU with external cap connection"]
    T --> U["CPU with external cap connection"]
    U --> V["CPU with external cap connection"]

GIGABYTE G493-ZB2 - Follow these instructions to install the CPU: - 2

  • Lock the CPU by using a Torx T20 screwdriver to tighten screw.
    • The screw tightening torque: 12.5-15.0 kgf-cm.

3-7 Installing the Memory

GIGABYTE G493-ZB2 - 3-7 Installing the Memory - 1

Read the following guidelines before you begin to install the memory:

  • Make sure that the motherboard supports the memory. It is recommended that memory of the same capacity, brand, speed, and chips be used.
    • Always turn off the computer and unplug the power cord from the power outlet before installing the memory to prevent hardware damage.
  • Memory modules have a foolproof design. A memory module can be installed in only one direction. If you are unable to insert the memory, switch the direction.

GIGABYTE G493-ZB2 - 3-7 Installing the Memory - 2

- Before you remove or install the memory module, please move the HDD cage towards to front first.

- Please see Section 3-4 "Moving the HDD Cage" for instructions.

3-7-1 Twelve Channel Memory Configuration

This motherboard provides 48 DDR5 memory slots and supports 12-Channel Technology. After the memory is installed, the BIOS will automatically detect the specifications and capacity of the memory.

GIGABYTE G493-ZB2 - 3-7-1 Twelve Channel Memory Configuration - 1

text_image CPU1 CPU0

3-7-2 Installing the Memory

GIGABYTE G493-ZB2 - 3-7-2 Installing the Memory - 1

Before installing a memory module, make sure to turn off the computer and unplug the power cord from the power outlet to prevent damage to the memory module.

Be sure to install DDR5 DIMMs on this motherboard.

Follow these instructions to install the Memory:

  1. Insert the DIMM memory module vertically into the DIMM slot, and push it down.
  2. Close the plastic clip at both edges of the DIMM slots to lock the DIMM module.
  3. Reverse the installation steps when you want to remove the DIMM module.

GIGABYTE G493-ZB2 - Follow these instructions to install the Memory: - 1

text_image Technical diagram showing assembly steps of a memory module with labeled components and structural details

3-7-3 Processor and Memory Module Matrix Table

Memory Q'ty for each CPUCPU0CPU1
L1L0K1K0J1J0I1I0H1H0G1G0A0A1B0B1C0C1D0D1E0E1F0F1X1X0W1W0V1V0U1U0T1T0S1S0M0M1N0N1C0D1P0P1Q0Q1R0R1
1 DIMMVV
2 DIMMVVVV
VVVV
4 DIMMVVVVVVVV
VVVVVVVV
6 DIMMVVVVVVVVVVVV
8 DIMMVVVVVVVVVVVVVVV
VVVVVVVVVVVVVVVV
10 DIMMVVVVVVVVVVVVVVVVVVV
12 DIMMVVVVVVVVVVVVVVVVVVVVVVV
VVVVVVVVVVVVVVVVVVVVVVV
16 DIMMVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVWWVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVV V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V W V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V V F V V F V F V F V F V F V F V F V F V F V F V F V F V F V F V F V F V F V F V F V F V F V F V F V F V F V F V F V F V F V F V F V F V F V F V F V F V F V F V F V F V F V F V F V F V F V F V F V F V F V F V V F V F V F V F V F V F V F V F V F V F V F V F V F V F V F V F V F V F V F V F V F V F V F V F V F V F V F V F V F V F V F V F V F V F V F F V F F V F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F FCPU0
1 DIMM
2 DIMMVV
4 DIMMVVVVVVV
VVVVVVVVVVVVVVVVVV
6 DIMMVVVVVVVVVVVV
8 DIMM
VVVVVVVVVVVVV
10 DIMMVVVVVVVVVVVVVVVVVVVV
12 DIMMVVVVVVVVVVVVVVVVVVVVVVV
VVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVV
16 DIMMVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWwwWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWHWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWHHWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW WWW W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W WW W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W W WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WW WAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAW WAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAwWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAw WAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWA WWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWA WVAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWEWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWQAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWWAWVAWVAWVAWVAWVAWVAWVAWVAWVAWVAWVAWVAWVAWVAWVAWVAWVAWVAWVAWVAWVAWVAWVAWVAWVAWVAWVAWVAWVAWVAWVAWVAWVAWVAWVAWVAWVAWVAWVAWVAWVAWVAWVAWVAWVAWVAWVAWVAWVAWVAWFAAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFCFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFAFLAFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFSFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFAFFTAFFACPU0CPU0CPU0CPU0CPU0CPU0CPU0CPU0CPU0CPU0CPU0CPU0CPU0CPU0CPU0CPU0CPU0CPU0CPU0CPU0CPU0CPU0CPU0CPU0CPU0CPU0CPU0CPU0CPU0CPU0CPU0CPU0CPU0CPU0

3-7-4 DIMM Population Table

EPYC Memory Speed based on DIMM Population (Two DIMM per Channel)

DIMM TypeDIMM Population DDR5 Frequency (MT/s)
DIMM 0 DIMM114L 93mil high-Dk PCB stackup14L 74mil high-Dk PCB stackup16L 93mil high-Dk PCB stackup
RDIMM-- 1R 48004800 4800
1R 1R 40004000 4000
-- 2R 44004800 4800
1R 2R 36003600 3600
2R 2R 36003600 3600
3DS RDIMM-- 2S2R (4 Ranks)4400 4800 4800
-- 2S4R (8 Ranks)4400 4800 4800
--2S8R (16 Ranks)4400 48004800
2S2R (4 Ranks)2S2R (4 Ranks)3600 3600 3600
2S4R (8 Ranks)2S4R (8 Ranks)3600 3600 3600
2S8R (16 Ranks)2S8R (16 Ranks)3600 36003600

3-8 Installing the Hard Disk Drive

GIGABYTE G493-ZB2 - 3-8 Installing the Hard Disk Drive - 1

Read the following guidelines before you begin to install the hard disk drive:

• Take note of the drive tray orientation before sliding it out.
• The tray will not fit back into the bay if inserted incorrectly.
- Make sure that the hard disk drive is connected to the hard disk drive connector on the backplane.

Follow these instructions to install a 2.5" HDD:

  1. Press the release button.
  2. Extend the locking lever.
  3. Pull the locking lever in the direction indicated to remove the HDD tray.
  4. Align the hard disk drive with the positioning stud on the HDD tray.
  5. Slide the hard disk drive into the HDD tray.
  6. Reinsert the HDD tray into the slot and close the locking lever.

GIGABYTE G493-ZB2 - Follow these instructions to install a 2.5" HDD: - 1

text_image Technical diagram showing five steps of assembling a server chassis, labeled 1 to 5 with Chinese annotations.

3-9 Installing the M.2 Device and Heat Sink

GIGABYTE G493-ZB2 - 3-9 Installing the M.2 Device and Heat Sink - 1

CAUTION

The position of the stand-off screw will depend on the size of the M.2 device. The stand-off screw is pre-installed for 22110 cards as standard. Refer to the size of the M.2 device and change the position of the stand-off screw accordingly.

GIGABYTE G493-ZB2 - CAUTION - 1

WARNING:

Please ensure a heatsink is attached to any M.2 device installed into the system. Installing an M.2 device without any heatsink may result in the system overheating or system performance being throttled.

GIGABYTE G493-ZB2 - WARNING: - 1

- To install/remove the M.2 module and Heatsink use a No. 1 Phillips-head screwdriver with a screw torque of 1.5 ± 0.2 kgf^* cm

Follow these instructions to install the M.2 device and heat sink:

  1. Insert the M.2 device into the M.2 connector.
  2. Press down on the M.2 device.
  3. Install the thermal pad of the M.2 device to the M.2 device.
  4. Press down on the thermal pad.
  5. Secure the M.2 device and its thermal pad to the motherboard with a single screw.
  6. Reverse steps 1-2 to remove the M.2 device.

GIGABYTE G493-ZB2 - Follow these instructions to install the M.2 device and heat sink: - 1

text_image Diagram showing five steps of a mechanical assembly or device with numbered components and directional arrows indicating movement.

3-10 Replacing the System Fan Module

GIGABYTE G493-ZB2 - 3-10 Replacing the System Fan Module - 1

CAUTION!

Before you remove or install the system fans follow these steps:

  • Make sure the system is not turned on or connected to AC power.
  • Disconnect all necessary cable connections. Failure to observe these warnings could result in personal injury or damage to the equipment.

Follow these instructions to replace the system fan module:

  1. Grasp the finger slots of the fan module and pull up to remove the fan module.
  2. Reverse the previous steps to install the replacement fan module.

GIGABYTE G493-ZB2 - Follow these instructions to replace the system fan module: - 1

text_image Technical diagram of a ship's internal structure with numbered annotations indicating components and flow directions.

3-11 Removing and Installing the Power Supply

GIGABYTE G493-ZB2 - 3-11 Removing and Installing the Power Supply - 1

CAUTION!

  • In order to reduce the risk of injury from electric shock, disconnect AC power from the power supply before removing the power supply from the system.
  • Please see Section 2-2 "Rear View" for installation sequence.

Follow these instructions to replace the power supply:

  1. Flip and then grasp the power supply handle.
  2. Press the retaining clip on the top side of the power supply in the direction indicated.
  3. Pull out the power supply using the handle.
  4. Insert the replacement power supply firmly into the chassis. Connect the AC power cord to the replacement power supply.

GIGABYTE G493-ZB2 - Follow these instructions to replace the power supply: - 1

text_image Technical diagram showing exploded view of a computer drive with labeled components and directional arrows indicating motion.

3-12 Cable Connection

3-12-1 Motherboard to PCIe Board and Front Side Low-Profile Card Cable

GIGABYTE G493-ZB2 - 3-12-1 Motherboard to PCIe Board and Front Side Low-Profile Card Cable - 1

text_image PEX0 PEX1 C1 C2 D1 D2 E1 G F1 F2 G E F B CPU1 CPU0 A D C A B
A PCIe Slot Signal CableMotherboard: U2_P0_P3
Front Side: SLOT2
B PCIe Slot Signal CableMotherboard: U2_P1_P3
Front Side: SLOT1
C PCIe Slot Signal CableMotherboard: U2_P0_P1
PCIe Board: U2_1/ U2_2
D PCIe Slot Signal CableMotherboard: U2_P0_P2
PCIe Board: MCIO3_1/ MCIO3_2
E PCIe Slot Signal CableMotherboard: U2_P1_P1
PCIe Board: U2_5/ U2_6
F PCIe Slot Signal CableMotherboard: U2_P1_P2
PCIe Board: MCIO5_1/ MCIO5_2
GPower Board Side Band Signal CableMotherboard: PDB_IO
PCIe Board: PWR_IO

3-12-2 PCIe Board to Rear Top PCIe Card Cable
GIGABYTE G493-ZB2 - 3-12-1 Motherboard to PCIe Board and Front Side Low-Profile Card Cable - 2

text_image A SLOT11 B SLOT9 C SLOT12 D SLOT10 PEX0 PEX1 D1 D2 C2 C1 B2 B1 A2 A1 RP
A PCIe Slot Signal CablePCIe Board: MCIO1_1/ MCIO1_2
Rear Side: SLOT11
B PCIe Slot Signal CablePCIe Board: MCIO2_1/ MCIO2_2
Rear Side: SLOT9
C PCIe Slot Signal CablePCIe Board: MCIO7_1/ MCIO7_2
Rear Side: SLOT12
D PCIe Slot Signal CablePCIe Board: MCIO8_1/ MCIO8_2
Rear Side: SLOT10

3-12-3 Motherboard to HDD Backplane Board and PCIe Board
GIGABYTE G493-ZB2 - 3-12-1 Motherboard to PCIe Board and Front Side Low-Profile Card Cable - 3

text_image PEX0 PEX1 A B H H I G E CPU1 CPU0 A D F C B F D G H D H C I E I I
ABackplane Board Signal CableMotherboard: BP_1PCIe Board: BP_1
BBackplane Board Signal CablePCIe Board: BP_SERIES1Backplane Board: BP_1
CBackplane Board Power CableMotherboard Board: HDD_PWRBackplane Board: ATX1/ATX2
D SATA CableMotherboard: U2_P0_P0ABackplane Board: SL_SAS0/SL_SAS1
E SATA CableMotherboard: U2_P1_P0ABackplane Board: SL_SAS2
F NVMe CableMotherboard: U2_P0_P0BBackplane Board: U.2 0/U.2 1
G NVMe CableMotherboard: U2_P1_P0BBackplane Board: U.2 2/U.2 3
H NVMe CablePCIe Board: MCIO4_1/MCIO4_2Backplane Board: U.2 4/U.2 5/U.2 6/U.2 7
I NVMe CablePCIe Board: MCIO6_1/MCIO6_2Backplane Board: U.2 8/U.2 9/U.2 10/U.2 11

Chapter 4 Motherboard Components

4-1 Motherboard Components
GIGABYTE G493-ZB2 - Chapter 4 Motherboard Components - 1

text_image CPU1 CPU0
Item Description
1 SlimLine Connector (for Power Board Side Band Signal)
2 CPU0 Power Connector
3 MCIO Connector (U2_P1_P0B/U2_P1_P0A/PCIe Gen5)
4 MCIO Connector (U2_P1_P1/PCIe Gen5)
5 MCIO Connector (U2_P1_P2/PCIe Gen5)
6 MCIO Connector (U2_P1_P3/PCIe Gen5)
7 CPU1 Power Connector
8 System Power Connector
9 2 x 2 Pin PCIE1 Power Connector
10 IPMB Connector
11 CPU1 Fan Connector (for CPU1 Heatsink)
12 SlimLine Connector (for Delta Module Link)
13 2 x 7 Pin HDD Backplane Board Power Connector
14 2 x 2 Pin PCIE4 Power Connector
15 M.2 Slot (PCIe Gen3 x4, Support NGFF-22110)
16 FAN_7_8 Connector
17 FAN_5_6 Connector
18 G-SC Module Connector
19 TPM Module Connector
20 MCIO Connector (U2_P0_P0B/U2_P0_P0A/PCIe Gen5)
21 MCIO Connector (U2_P0_P1/PCIe Gen5)
22 MCIO Connector (U2_P0_P2/PCIe Gen5)
23 MCIO Connector (U2_P0_P3/PCIe Gen5)
24 2 x 2 Pin PCIE3 Power Connector
25 HDD Backplane Board Connector
26 Battery Socket
27 CPU0 Fan Connector (for CPU0 Heatsink)
28 2 x 2 Pin PCIE2 Power Connector
29 M.2 Slot (PCIe Gen3 x4, Support NGFF-22110)
30 FAN_1_2 Connector
31 FAN_3_4 Connector

4-2 Jumper Setting

GIGABYTE G493-ZB2 - 4-2 Jumper Setting - 1

text_image Clear CMOS 1 Default CLR_CMOS 2 Enable J1 ON OFF 1 SMB_SEL BIOS Defined 2 -- -- 3 BIOS_PWD Clear supervisor password Normal [Default] 4 BIOS_RCVR BIOS recovery mode Normal [Default]

4-3 G-SC Module

4-3-1 CDCG110

GIGABYTE G493-ZB2 - 4-3-1 CDCG110 - 1

text_image BMC Readiness LED BIOS2 BIOS1 BMC1 ① ② ③ ④
Item Description
1USB 3.2 Gen1 Port x 2
210/100/1000 Server Management LAN Port
3 VGA Port
41GbE LAN Port x 2

4-4 Backplane Board Storage Connector

4-4-1 CBP10C2

GIGABYTE G493-ZB2 - 4-4-1 CBP10C2 - 1

flowchart
graph TD
    A["11"] --> B["12"]
    C["9"] --> D["15"]
    E["7"] --> F["10"]
    G["5"] --> H["8"]
    I["3"] --> J["14"]
    K["1"] --> L["2"]
    M["4"] --> N["6"]
    O["13"] --> P["13"]
Item Description
1. MCIO Connector (MCIO 4i/U.2_0)
2. MCIO Connector (MCIO 4i/U.2_1)
3. MCIO Connector (MCIO 4i/U.2_2)
4. MCIO Connector (MCIO 4i/U.2_3)
5. MCIO Connector (MCIO 4i/U.2_4)
6 MCIO Connector (MCIO 4i/U.2_5)
7. MCIO Connector (MCIO 4i/U.2_6)
8. MCIO Connector (MCIO 4i/U.2_7)
9. MCIO Connector (MCIO 4i/U.2_8)
10. MCIO Connector (MCIO 4i/U.2_9)
11. MCIO Connector (MCIO 4i/U.2_10)
12. MCIO Connector (MCIO 4i/U.2_11)
13. SlimLine Connector (SFF-8654 4i/SL_SAS0)
14. SlimLine Connector (SFF-8654 4i/SL_SAS1)
15. SlimLine Connector (SFF-8654 4i/SL_SAS2)

Chapter 5 BIOS Setup

BIOS (Basic Input and Output System) records hardware parameters of the system in the EFI on the motherboard. Its major functions include conducting the Power-On Self-Test (POST) during system startup, saving system parameters, loading the operating system etc. The BIOS includes a BIOS Setup program that allows the user to modify basic system configuration settings or to activate certain system features. When the power is turned off, the battery on the motherboard supplies the necessary power to the CMOS to keep the configuration values in the CMOS.

To access the BIOS Setup program, press the key during the POST when the power is turned on.

GIGABYTE G493-ZB2 - Chapter 5 BIOS Setup - 1

  • BIOS flashing is potentially risky, if you do not encounter any problems when using the current BIOS version, it is recommended that you don't flash the BIOS. To flash the BIOS, do it with caution. Inadequate BIOS flashing may result in system malfunction.
  • It is recommended that you not alter the default settings (unless you need to) to prevent system instability or other unexpected results. Inadequately altering the settings may result in system's failure to boot. If this occurs, try to clear the CMOS values and reset the board to default values. (Refer to the Exit section in this chapter or introductions of the battery/clearing CMOS jumper in Chapter 4 for how to clear the CMOS values.)

BIOS Setup Program Function Keys

<←><→>Move the selection bar to select the screen
<↑><↓>Move the selection bar to select an item
<+>Increase the numeric value or make changes
<->Decrease the numeric value or make changes
Execute command or enter the submenu
Main Menu: Exit the BIOS Setup programSubmenus: Exit current submenu
Show descriptions of general help
Restore the previous BIOS settings for the current submenus
Load the Optimized BIOS default settings for the current submenus
Save all the changes and exit the BIOS Setup program

Main

This setup page includes all the items of the standard compatible BIOS.

■ Advanced

This setup page includes all the items of AMI BIOS special enhanced features.

(ex: Auto detect fan and temperature status, automatically configure hard disk parameters.)

AMD CBS

This setup page includes the common items for configuration of AMD motherboard-related information.

AMD PBS Option

This setup page includes the common items for configuration of AMD CPM RAS related settings.

Chipset

This setup page includes all the submenu options for configuring the functions of the North Bridge.

■ Server Management

Server additional features enabled/disabled setup menus.

■ Security

Change, set, or disable supervisor and user password. Configuration supervisor password allows you to restrict access to the system and BIOS Setup.

A supervisor password allows you to make changes in BIOS Setup.

A user password only allows you to view the BIOS settings but not to make changes.

Boot

This setup page provides items for configuration of the boot sequence.

■ Save & Exit

Save all the changes made in the BIOS Setup program to the CMOS and exit BIOS Setup. (Pressing can also carry out this task.)

Abandon all changes and the previous settings remain in effect. Pressing to the confirmation message will exit BIOS Setup. (Pressing can also carry out this task.)

5-1 The Main Menu

Once you enter the BIOS Setup program, the Main Menu (as shown below) appears on the screen. Use arrow keys to move among the items and press to accept or enter other sub-menu.

The on-screen description of a highlighted setup option is displayed on the bottom line of the Main Menu.

While in a submenu, press to display a help screen (General Help) of function keys available for the menu. Press to exit the help screen. Help for each item is in the Item Help block on the right side of the submenu.

GIGABYTE G493-ZB2 - Submenu Help - 1

  • When the system is not stable as usual, select the Restore Defaults item to set your system to its defaults.
  • The BIOS Setup menus described in this chapter are for reference only and may differ by BIOS version.

GIGABYTE G493-ZB2 - Submenu Help - 2

text_image Aptio Setup - AMI Main Advanced AMD CBS AMD PBS Option Chipset Server Mgmt Security Boot Save & Exit BIOS Information Project Name M2B3-641-000 Project Version D03 Build Date and Time 02/10/2023 10:00:13 BMC Information BMC Firmware Version 13.04.13 Processor Information CPU 0 Brand String AMD EPYC 9654 96-Core CPU 1 Brand String Processor CPU Speed 2400 MHz Processor Core 192 Cores 192 Threads Microcode Patch A101111 Total Memory 786432 MB (DDR5) Memory Speed 4800 MT/s VR Information Version FFFF AGESA PI Version PI Version 1.0.0.3 +:-: Select Screen +:-: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI

GIGABYTE G493-ZB2 - Submenu Help - 3

text_image Aptio Setup - AMI Main Advanced AMD COS AMD PBS Option Chipset Server Mgmt Security Boot Save & Exit Processor Information CPU 0 Brand String CPU 1 Brand String CPU Speed Processor Core Microcode Patch Total Memory Memory Speed VR Information Version AGESA PI Version PI Version Onboard LAN Information LAN1 MAC Address LAN2 MAC Address System Date System Time AMD EPYC 9654 96-Core Processor AMD EPYC 9654 96-Core Processor 2400 MHz 192 Cores 192 Threads A101111 786432 MB (DDR5) 4800 MT/s FFFF 1.0.0.3 D8-5E-D3-E3-F3-F3 D8-5E-D3-E3-F3-F4 [Thu 02/23/2023] [10:26:35] Set the Time. Use Tab to switch between Time elements. +: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI
ParameterDescription
BIOS Information
Project NameDisplays the project name information.
Project VersionDisplays version number of the BIOS setup utility.
Build Date and TimeDisplays the date and time when the BIOS setup utility was created.
BMC Information^(Note1)
BMC Firmware Version^(Note1) Displays BMC firmware version information.
Processor Information
CPU Brand String/ CPU Speed / Processor Core / Microcode PatchDisplays the technical specifications for the installed processor(s).
Total Memory^(Note2) Displays the total memory size of the installed memory.
Memory Speed^(Note2) Displays the frequency information of the installed memory.
VR Information Version Displays VR version information.
AGESA PI Version
PI Version Displays AGESA PI version information.

(Note1) Functions available on selected models.
(Note2) This section will display capacity and frequency information of the memory that the customer has installed.

ParameterDescription
Onboard LAN Information
LAN1/LAN2 MAC Address ^(Note) Displays LAN MAC address information.
System DateSets the date following the weekday-month-day-year format.
System TimeSets the system time following the hour-minute-second format.

(Note) The number of LAN ports listed will depend on the motherboard / system model.

5-2 Advanced Menu

The Advanced Menu displays submenu options for configuring the function of various hardware components. Select a submenu item, then press to access the related submenu screen.

When Boot Mode Select is set to UEFI (Default)

GIGABYTE G493-ZB2 - When Boot Mode Select is set to UEFI (Default) - 1

text_image Aptio Setup - AMI Main Advanced AMD CBS AMD PBS Option Chipset Server Hgmt Security Boot Save & Exit Trusted Computing PSP Firmware Versions Legacy Video Select AST2600 Super IO Configuration S5 RTC Make Settings Serial Port Console Redirection CPU Configuration PCI Subsystem Settings USB Configuration Network Stack Configuration NVMe Configuration SATA Configuration Graphic Output Configuration AMD Mem Configuration Status Tis Auth Configuration RAM Disk Configuration iSCSI Configuration Intel(R) I350 Gigabit Network Connection - D8:SE:D3:E3:F3:F3 VLAN Configuration (MAC:D85ED3E3F3F3) MAC:D85ED3E3F3F3-IPv4 Network Configuration MAC:D85ED3E3F3F3-IPv6 Network Configuration Intel(R) I350 Gigabit Network Connection - D8:SE:D3:E3:F3:F4 VLAN Configuration (MAC:D85ED3E3F3F4) MAC:D85ED3E3F3F4-IPv4 Network Configuration Trusted Computing Settings +: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI

When "Boot Mode Select" is set to Legacy in the Boot > Boot Mode Select section

GIGABYTE G493-ZB2 - When "Boot Mode Select" is set to Legacy in the Boot &gt; Boot Mode Select section - 1

text_image Aptio Setup - AMI Main Advanced AMD CBS AMD PBS Option Chipset Server Mgmt Security Boot Save & Exit Trusted Computing PSP Firmware Versions Legacy Video Select AST2600 Super IO Configuration S5 RTC Wake Settings Serial Port Console Redirection CPU Configuration PCI Subsystem Settings USB Configuration Network Stack Configuration NVMe Configuration SATA Configuration AMD Mem Configuration Status Tls Auth Configuration RAM Disk Configuration iSCSI Configuration Trusted Computing Settings +: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI

5-2-1 Trusted Computing

GIGABYTE G493-ZB2 - 5-2-1 Trusted Computing - 1

text_image Aptio Setup - AMI Advanced Configuration Security Device Support [Enable] SPI TPM Support [Enabled] NO Security Device Found Enables or Disables BIOS support for security device. O.S. will not show Security Device. TCG EFI protocol and INTIA interface will not be available. +: Select Screen +: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI
ParameterDescription
Configuration
Security Device SupportEnable/Disable BIOS support for security device. OS will not show security device. TCG EFI protocol and INT1A interface will not be available.Options available: Disable, Enable. Default setting is Enable.
SPI TPM SupportSelect Enable to activate TPM support feature.Options available: Disabled, Enabled. Default setting is Enabled.

5-2-2 PSP Firmware Versions

The PSP Firmware Versions page displays the basic PSP firmware version information. Items on this window are non-configurable.

PSP Firmware Versions
ABL Version 10038017 PSP BootLoader Version 00.29.00.78 SMU FW Version 04.71.88.00 SEV FW Version 01.01.35.05 PHY FW Version 00.01.33.00 MPIQ FW Version 01.00.13.9D TF MPDMA FW Version 00.47.03.00 PM MPDMA FW Version 00.47.34.00 GMI FW Version AB.01.27.00 RIB FW Version 02.00.08.28 SEC FW Version 00.0E.90.5C PMU FW Version 00.00.90.43 uCode B1 Version A101111
APCB Version 0000 APOB Version 0000 APPB Version 0000++: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit

5-2-3 Legacy Video Select

GIGABYTE G493-ZB2 - 5-2-3 Legacy Video Select - 1

text_image Optio Setup - AMI Advanced OnBrd/Ext VGA Select [Auto] Select between onboard or external VGA support. +: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI
ParameterDescription
OnBrd/Ext VGA SelectSelects between onboard or external VGA support. Options available: Auto, Onboard, External. Default setting is Auto.

(Note) This configurable option will be displayed when "Boot Mode Select" is set to Legacy in the Boot > Boot Mode Select section.

5-2-4 AST2600 Super IO Configuration

GIGABYTE G493-ZB2 - 5-2-4 AST2600 Super IO Configuration - 1

text_image Advanced Aptio Setup - AMI AST2600 Super IO Configuration Super IO Chip AST2600 Serial Port 1 Configuration Set Parameters of Serial Port 1 (COMA) +: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI
ParameterDescription
AST2600 Super IO Configuration
Super IO Chip Displays the super IO chip information
Serial Port 1 ConfigurationPress [Enter] for configuration of advanced items.

5-2-4-1 Serial Port 1 Configuration

GIGABYTE G493-ZB2 - 5-2-4-1 Serial Port 1 Configuration - 1

text_image Advanced Serial Port 1 Configuration Serial Port [Enabled] Device Settings IO=3F8h; IRQ=4; Change Settings [Auto] Enable or Disable Serial Port (COM) +: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI
ParameterDescription
Serial Port 1 Configuration
Serial Port ^(Note) Enable/Disable the Serial Port (COM). When set to Enabled allows you to configure the Serial port 1 settings. When set to Disabled, displays no configuration for the serial port.Options available: Disabled, Enabled. Default setting isEnabled.
Devices Settings Displays the Serial Port 1 device settings.
Change SettingsSelect an optimal settings for Super IO Device.Options available for Serial Port 1:AutoIO=3F8h; IRQ=4;IO=3F8h; IRQ=3, 4, 5, 6, 7, 9, 10, 11, 12;IO=2F8h; IRQ=3, 4, 5, 6, 7, 9, 10, 11, 12;IO=3E8h; IRQ=3, 4, 5, 6, 7, 9, 10, 11, 12;IO=2E8h; IRQ=3, 4, 5, 6, 7, 9, 10, 11, 12;Default setting isAuto.

(Note) Advanced items prompt when this item is defined.

5-2-5 S5 RTC Wake Settings

GIGABYTE G493-ZB2 - 5-2-5 S5 RTC Wake Settings - 1

text_image Aptio Setup - AMI Advanced Wake system from S5 [Disabled] Enable or disable System wake on alarm event. Select FixedTime, system will wake on the hr::min::sec specified. Select DynamicTime, System will wake on the current time + Increase minute(s) +: Select Screen +: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI
ParameterDescription
Wake System from S5Enable/Disable system wake on alarm event. Options available: Disabled, Fixed Time, Dynamic Time. When Fixed Time is selected, system will wake on the hr::min::sec specified. Default setting is Disabled.

5-2-6 Serial Port Console Redirection

GIGABYTE G493-ZB2 - 5-2-6 Serial Port Console Redirection - 1

text_image Aptio Setup - AMI Advanced COM1/SOL Console Redirection [Disabled] ► Console Redirection Settings Legacy Console Redirection ► Legacy Console Redirection Settings Serial Port for Out-of-Band Management/ Windows Emergency Management Services (EMS) Console Redirection EMS [Disabled] ► Console Redirection Settings Console Redirection Enable or Disable. ++: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI
ParameterDescription
COM1/Serial Over LANConsole Redirection ^(Note) Select whether to enable console redirection for specified device. Console redirection enables the users to manage the system from a remote location.Options available: Enabled, Disabled. Default setting isDisabled.
COM1/Serial Over LANConsole Redirection SettingsPress [Enter] to configure advanced items.Please note that this item is configurable when COM1/Serial Over LAN Console Redirection is set to Enabled.Terminal Type- Selects a terminal type to be used for console redirection.- Options available: VT100, VT100+, ANSI, VT-UTF8. Default setting isANSI.Bits per second- Selects the transfer rate for console redirection.- Options available: 9600, 19200, 38400, 57600, 115200. Default setting is115200.Data Bits- Selects the number of data bits used for console redirection.- Options available: 7, 8. Default setting is8.

(Note) Advanced items prompt when this item is defined.

ParameterDescription
COM1/Serial Over LAN Console Redirection Settings (continued)Parity– A parity bit can be sent with the data bits to detect some transmission errors.– Even: parity bit is 0 if the num of 1's in the data bits is even.– Odd: parity bit is 0 if num of 1's in the data bits is odd.– Mark: parity bit is always 1. Space: Parity bit is always 0.– Mark and Space Parity do not allow for error detection.– Options available: None, Even, Odd, Mark, Space. Default setting is None.Stop Bits– Stop bits indicate the end of a serial data packet. (A start bit indicates the beginning). The standard setting is 1 stop bit.Communication with slow devices may require more than 1 stop bit.– Options available: 1, 2. Default setting is 1.Flow Control– Flow control can prevent data loss from buffer overflow. When sending data, if the receiving buffers are full, a 'stop' signal can be sent to stop the data flow. Once the buffers are empty, a 'start' signal can be sent to re-start the flow. Hardware flow control uses two wires to send start/stop signals.– Options available: None, Hardware RTS/CTS. Default setting is None.VT-UTF8 Combo Key Support– Enable/Disable the VT-UTF8 Combo Key Support.– Options available: Enabled, Disabled. Default setting is Enabled.Recorder Mode– When this mode enabled, only texts will be send. This is to capture Terminal data.– Options available: Enabled, Disabled. Default setting is Disabled.Resolution 100x31– Enable/Disable extended terminal resolution.– Options available: Enabled, Disabled. Default setting is Enabled.Putty KeyPad– Selects Function Key and KeyPad on Putty.– Options available: VT100, LINUX, XTERMR6, SC0, ESCN, VT400. Default setting is VT100.
Legacy Console Redirection
Legacy Console Redirection SettingsPress [Enter] to configure advanced items.◆Redirection COM Port-Selects a COM port for Legacy serial redirection.-Default setting isCOM1/SOL.◆Resolution-Selects the number of rows and columns used in Console Redirection for legacy OS support.-Options available: 80x24, 80x25. Default setting is80x24.◆Redirect After POST-When Bootloader is selected, then Legacy Console Redirection is disabled before booting to legacy OS. When Always Enable is selected, then Legacy Console Redirection is enabled for legacy OS.-Options available: Always Enable, BootLoader. Default setting isAlways Enable.
Serial Port for Out-of-Band Management / Windows Emergency Management Services (EMS) Console Redirection ^(Note) EMS console redirection allows the user to configure Console Redirection Settings to support Out-of-Band Serial Port management.Options available: Disabled, Enabled. Default setting isDisabled.
Serial Port for Out-of-Band EMS Console Redirection SettingsPress [Enter] to configure advanced items.Please note that this item is configurable when Serial Port for Out-of-Band Management EMS Console Redirection is set to Enabled.◆Out-of-Band Mgmt Port-Microsoft Windows Emergency Management Service (EMS) allows for remote management of a Windows Server OS through a serial port.-Default setting isCOM1/SOL.◆Terminal Type-Selects a terminal type to be used for console redirection.-Options available: VT100, VT100+, ANSI, VT-UTF8. Default setting isANSI.◆Bits per second-Selects the transfer rate for console redirection.-Options available: 9600, 19200, 57600, 115200. Default setting is115200.

(Note) Advanced items prompt when this item is defined.

ParameterDescription
Serial Port for Out-of-Band EMS Console Redirection Settings(continued)Flow Control– Flow control can prevent data loss from buffer overflow. When sending data, if the receiving buffers are full, a 'stop' signal can be sent to stop the data flow. Once the buffers are empty, a 'start' signal can be sent to re-start the flow. Hardware flow control uses two wires to send start/stop signals.– Options available: None, Hardware RTS/CTS, Software Xon/Xoff. Default setting is None.

5-2-7 CPU Configuration

GIGABYTE G493-ZB2 - 5-2-7 CPU Configuration - 1

text_image Advanced CPU Configuration SVM Mode [Enabled] ► CPU 0 Information ► CPU 1 Information Enable/disable CPU Virtualization +: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI
ParameterDescription
SVM ModeEnable/Disable the CPU Virtualization.Options available: Disabled, Enabled. Default setting is Enabled.
CPU 0/1 InformationPress [Enter] to view the memory information related to CPU 0/1.

5-2-8 PCI Subsystem Settings

GIGABYTE G493-ZB2 - 5-2-8 PCI Subsystem Settings - 1

text_image PCI Bus Driver Version U2_P0_P1 U2_P0_P1 ROM U2_P0_P2 Link Speed U2_P0_P2 U2_P0_P2 I/O ROM U2_P0_P3 Link Speed U2_P0_P3 U2_P0_P3 I/O ROM U2_P1_P0 Link Speed U2_P1_P1 U2_P1_P1 I/O ROM U2_P1_P3 Link Speed U2_P1_P2 U2_P1_P2 I/O ROM U2_P0_G3 Link Speed U2_P1_P3 U2_P1_P3 I/O ROM U2_P1_G1 Link Speed A5.01.28 [Auto] [Enabled] [Auto] [Auto] [Enabled] [Auto] [Auto] [Enabled] [Auto] [Auto] [Auto] [Auto] [Auto] [Auto] Change U2_P0_P1 PCIe lanes. ++: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI

GIGABYTE G493-ZB2 - 5-2-8 PCI Subsystem Settings - 2

text_image Advanced U2_P0_P3 [Auto] U2_P0_P3 I/O ROM [Enabled] U2_P1_P0 Link Speed [Auto] U2_P1_P1 [Auto] U2_P1_P1 I/O ROM [Enabled] U2_P1_P3 Link Speed [Auto] U2_P1_P2 [Auto] U2_P1_P2 I/O ROM [Enabled] U2_P0_G3 Link Speed [Auto] U2_P1_P3 [Auto] U2_P1_P3 I/O ROM [Enabled] U2_P1_G1 Link Speed [Auto] Onboard LAN Controller [Enabled] Onboard LAN1 I/O ROM [Enabled] Onboard LAN2 I/O ROM [Enabled] PCI Devices Common Settings: Above 4G Decoding [Enabled] SR-IOV Support [Enabled] Relaxed Ordering [Enabled] Enables or Disables PCI Express Device Relaxed Ordering. +: Select Screen +: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI
ParameterDescription
PCI Bus Driver VersionDisplays the PCI Bus Driver version information.
U2_P0_P1/2/3, U2_P1_P1/2/3 ^(Note1) Change the PCIe lanes.Options available: Disabled, Auto, x16, x8x8, x8x4x4, x4x4x8,x4x4x4x4. Default setting isAuto.
U2_P0_P1/2/3, U2_P1_P1/2/3I/O ROM ^(Note1) When enabled, this setting will initialize the device expansion ROM for the related PCI-E slot.Options available: Disabled, Enabled. Default setting isEnabled.
U2_P0_P2/P3/G3, U2_P1_P0/P3/G1Link Speed ^(Note1) Configure PCIe max link speed.Options available: Auto, Gen4, Gen3, Gen2, Gen1.Default setting isAuto.
Onboard LAN Controller ^(Note2) Enable/Disable the onboard LAN devices.Options available: Disabled, Enabled. Default setting isEnabled.
Onboard LAN# I/O ROM ^(Note2) Enable/Disable the onboard LAN devices, and initializes device expansion ROM.Options available: Disabled, Enabled. Default setting isEnabled.
PCI Devices Common Settings
Above 4G DecodingEnable/Disable memory mapped I/O to 4GB or greater address space (Above 4G Decoding).Options available: Disabled, Enabled. Default setting isEnabled.
SR-IOV SupportIf the system has SR-IOV capable PCIe devices, this item Enable/Disable Single Root IO Virtualization Support.Options available: Disabled, Enabled. Default setting isEnabled.
Relaxed OrderingEnable/Disable PCI express device relaxed ordering.Options available: Disabled, Enabled. Default setting isEnabled.

(Note1) This section is dependent on the available PCIe lanes. (Note2) This section is dependent on the available LAN controller.

5-2-9 USB Configuration

Advanced Aptio Setup - AMI
USB Configuration USB Module Version 29 USB Controllers: 2 XHCIs USB Devices: 2 Drives, 1 Keyboard, 1 Mouse, 3 Hubs Legacy USB Support [Enabled] XHCI Hand-off [Enabled] USB Mass Storage Driver Support [Enabled]
USB hardware delays and time-outs: USB transfer time-out [20 sec] Device reset time-out [20 sec] Device power-up delay [Auto]
Mass Storage Devices: AMI Virtual CDROMO 1.00 [Auto] AMI Virtual HDiskO 1.00 [Auto]
Enables Legacy USB support. AUTO option disables legacy support if no USB devices are connected. DISABLE option will keep USB devices available only for EFI applications.
++: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit
Version 2.21.1279 Copyright (C) 2023 AMI
ParameterDescription
USB Configuration
USB Module VersionDisplays the USB module version information.
USB ControllersDisplays the supported USB controllers.
USB Devices:Displays the USB devices connected to the system.
Legacy USB SupportEnable/Disable the Legacy USB support function. AUTO option disables legacy support if no USB devices are connected. DISABLE option will keep USB devices available only for EFI applications.Options available: Enabled, Disabled, Auto. Default setting is Enabled.
XHCI Hand-offEnable/Disable the XHCI Hand-off support.Options available: Enabled, Disabled. Default setting is Enabled.
USB Mass Storage Driver Support ^(Note) Enable/Disable the USB Mass Storage Driver Support.Options available: Disabled, Enabled. Default setting is Enabled.
USB hardware delays and time-outs
USB transfer time-outSelects the time-out value for USB Control/Bulk/Interrupt transfers.Options available: 1 sec, 5 sec, 10 sec, 20 sec.Default setting is 20 sec.

(Note) This item is present only if you attach USB devices.

ParameterDescription
Device reset time-outSelects the time-out value during a USB mass storage device reset. Options available: 10 sec, 20 sec, 30 sec, 40 sec. Default setting is 20 sec.
Device power-up delayMaximum time the device will take before it properly reports itself to the Host Controller. "Auto" uses default value: for a Root port it is 100 ms, for a Hub port the delay is taken from Hub descriptor. Options available: Auto, Manual. Default setting is Auto.
Mass Storage Devices Displays the mass storage devices available on the system.

5-2-10 Network Stack Configuration

GIGABYTE G493-ZB2 - 5-2-10 Network Stack Configuration - 1

text_image Advanced Aptio Setup - AMI Network Stack [Enabled] Ipv4 PXE Support [Enabled] Ipv4 HTTP Support [Disabled] Ipv6 PXE Support [Enabled] Ipv6 HTTP Support [Disabled] PXE boot wait time 1 Media detect count 1 Enable/Disable UEFI Network Stack +: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit version 2.21.1275 Copyright (C) 2023 AMI
ParameterDescription
Network StackEnable/Disable the UEFI network stack.Options available: Enabled, Disabled. Default setting is Enabled.
Ipv4 PXE Support^(Note) Enable/Disable the lpv4 PXE feature.Options available: Enabled, Disabled. Default setting is Enabled.
Ipv4 HTTP Support^(Note) Enable/Disable the lpv4 HTTP feature.Options available: Enabled, Disabled. Default setting is Disabled.
Ipv6 PXE Support^(Note) Enable/Disable the lpv6 PXE feature.Options available: Enabled, Disabled. Default setting is Enabled.
Ipv6 HTTP Support^(Note) Enable/Disable the lpv6 HTTP feature.Options available: Enabled, Disabled. Default setting is Disabled.
PXE boot wait time^(Note) Wait time in seconds to press ESC key to abort the PXE boot.Press the <+> / <-> keys to increase or decrease the desired values.
Media detect count^(Note) Number of times the presence of media will be checked.Press the <+> / <-> keys to increase or decrease the desired values.

(Note) This item appears when Network Stack is set to Enabled.

5-2-11 NVMe Configuration

GIGABYTE G493-ZB2 - 5-2-11 NVMe Configuration - 1

text_image Aptio Setup - AMI Advanced NVMe controller and Drive information No NVME Device Found NVMe LED Control [System Default] Enable NVMe Led Control ++: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI
ParameterDescription
NVMe ConfigurationDisplays the NVMe devices connected to the system.
NVMe LED ControlEnable/Disable NVMe LED Control.Options available: System Default, Disabled, Enabled.Default setting is Enabled.

5-2-12 SATA Configuration

GIGABYTE G493-ZB2 - 5-2-12 SATA Configuration - 1

text_image SATA Configuration Port 0 Not Present Port 1 Not Present Port 2 Not Present Port 3 Not Present Port 4 Not Present Port 5 Not Present Port 6 Not Present Port 7 Not Present Port 8 Not Present Port 9 Not Present Port 10 Not Present Port 11 Not Present +:-: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI
ParameterDescription
SATA ConfigurationDisplays the installed HDD devices information. System will automatically detect HDD type.

5-2-13 Graphic Output Configuration
GIGABYTE G493-ZB2 - 5-2-12 SATA Configuration - 2

text_image Aptio Setup - AMI Advanced Graphic Output Configuration Output Device Type [Onboard Device] Select Output Device Type ++: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI
ParameterDescription
Output Device TypeSelects output device type. Options available: First loaded Device, Onboard Device, External Device, Specific Device. Default setting is Onboard Device.

5-2-14 AMD Mem Configuration Status

GIGABYTE G493-ZB2 - 5-2-14 AMD Mem Configuration Status - 1

text_image Advanced CPU 0 CPU 1 Mblst Test Enable Disabled, 0xC000 Mblst Aggressor Enable Disabled, 0xC000 Mblst Per Bit Slave Die Report 0x00FF, 0xC000 Dram Temp Controlled Refresh Disabled, 0xC001 Enable User Timing Mode Disabled, 0x0000 User Timing Value Disabled, 0x0000 Mem Bus Freq Limit Disabled, 0x0000 Enable Power Down Disabled, 0xC000 Dram Double Refresh Rate Disabled, 0x0000 Pmu Train Mode 0x0000, 0xC000 Ecc Symbol Size 0x0000, 0xC000 Uncorrectable Ecc Retry Disabled, 0xC004 Ignore Spd Checksum Disabled, 0xC000 Enable Bank Group Swap Alt Disabled, 0x0000 Enable Bank Group Swap Disabled, 0xC000 Odr Route Balanced Tee Disabled, 0xC004 Nvdim Power Source 0x0000, 0xC004 Odts Cmd Throt Enable Disabled, 0xC004 Odts Cmd Throt Cycle Disabled, 0xC004 Socket-specific memory configuration status +: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI
ParameterDescription
CPU 0/1Press [Enter] to view the memory configuration status related to CPU 0/1.

5-2-15 TIs Auth Configuration

GIGABYTE G493-ZB2 - 5-2-15 TIs Auth Configuration - 1

text_image Aptio Setup - AMI Advanced ► Server CA Configuration ► Client Cert Configuration Press to configure Server CA. +: Select Screen +: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI
Parameter Description
Server CA ConfigurationPress [Enter] for configuration of advanced items.◆ Enroll Cert- Press [Enter] to enroll a certificate• Enroll Cert Using File• Cert GUIDInput digit character in 1111111-2222-3333-4444-1234567890ab format.- Commit Changes and Exit- Discard Changes and Exit◆ Delete Cert
Client Cert ConfigurationPress [Enter] for configuration of advanced items.

5-2-16 RAM Disk Configuration

GIGABYTE G493-ZB2 - 5-2-16 RAM Disk Configuration - 1

text_image Advanced Disk Memory Type: [Boot Service Data] ► Create raw ► Create from file Created RAM disk list: Remove selected RAM disk(s). Specify type of memory to use from available memory pool in system to create a disk. +: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI
ParameterDescription
Disk Memory TypeSpecifies the type of memory to use from available memory pool in system to create a disk.Options available: Boot Service Data, Reserved.Default setting isBoot Service Data.
Create RawCreates a raw RAM diskSIZE (Hex)- Input a valid RAM disk size that should be multiple of the RAM disk block size.Create & ExitDiscard & Exit
Create from fileCreates a RAM disk from a given file.
Created RAM disk list
Remove selected RAM disk(s)Selects the RAM disk(s) to remove.

5-2-17 iSCSI Configuration

GIGABYTE G493-ZB2 - 5-2-17 iSCSI Configuration - 1

text_image Aptio Setup - AMI Advanced ISCSI Initiator Name ► Add an Attempt ► Delete Attempts ► Change Attempt Order The worldwide unique name of ISCSI Initiator. Only IQN format is accepted. Range is from 4 to 223 +: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI
ParameterDescription
iSCSI Initiator NamePress [Enter] and name iSCSI Initiator. Only IQN format is accepted. Range: from 4 to 223
Add an AttemptPress [Enter] to configure advanced items.
Delete AttemptsPress [Enter] to configure advanced items.
Change Attempt OrderPress [Enter] to configure advanced items.

5-2-18 Intel(R) I350 Gigabit Network Connection

GIGABYTE G493-ZB2 - 5-2-18 Intel(R) I350 Gigabit Network Connection - 1

text_image Aptio Setup - AMI Advanced NIC Configuration B1ink LEDs 0 UEFI Driver Intel(R) PRO/1000 8.5.21 PCI-E Adapter PBA 140422-008 Device Name Intel(R) I350 Gigabit Network Connection Chip Type Intel i350 PCI Device ID 1521 PCI Address 63:00:00 Link Status [Disconnected] MAC Address D8:5E:D3:E3:F3:F3 Virtual MAC Address 00:00:00:00:00:00 Click to configure the network device port. ++: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI
Aptio Setup - AMI
Link Speed [Auto Negotiated] Wake On LAN [Enabled]Specifies the port speed used for the selected boot protocol.
+: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit
Version 2.21.1279 Copyright (C) 2023 AMI
ParameterDescription
NIC ConfigurationPress [Enter] to configure advanced items.◆ Link Speed- Allows for automatic link speed adjustment.- Options available: Auto Negotiated, 10 Mbps Half, 10 Mbps Full, 100 Mbps Half, 100 Mbps Full. Default setting isAuto Negotiated.◆ Wake On LAN- Enables power on of the system via LAN. Note that configuring Wake on LAN in the operating system does not change the value of this setting, but does override the behavior of Wake on LAN in OS controlled power states.- Options available: Disabled, Enabled. Default setting isEnabled.
Blink LEDsIdentifies the physical network port by blinking the associated LED. Press the numeric keys to adjust desired values.
UEFI DriverDisplays the technical specifications for the Network Interface Controller.
Adapter PBADisplays the technical specifications for the Network Interface Controller.
Device NameDisplays the technical specifications for the Network Interface Controller.
Chip TypeDisplays the technical specifications for the Network Interface Controller.
PCI Device IDDisplays the technical specifications for the Network Interface Controller.
PCI AddressDisplays the technical specifications for the Network Interface Controller.
Link StatusDisplays the technical specifications for the Network Interface Controller.
MAC AddressDisplays the technical specifications for the Network Interface Controller.
Virtual MAC AddressDisplays the technical specifications for the Network Interface Controller.

5-2-19 VLAN Configuration

GIGABYTE G493-ZB2 - 5-2-19 VLAN Configuration - 1

text_image Aptio Setup - AMI Advanced Create new VLAN VLAN ID 0 Priority 0 Add VLAN Configured VLAN List Remove VLAN VLAN ID of new VLAN or existing VLAN, valid value is 0~4094 ++: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI
ParameterDescription
Enter Configuration MenuPress [Enter] to configure advanced items.◆ Create new VLAN◆ VLAN ID- Sets VLAN ID for a new VLAN or an existing VLAN.- Press the <+> / <-> keys to increase or decrease the desired values.- The valid range is from 0 to 4094.◆ Priority- Sets 802.1Q Priority for a new VLAN or an existing VLAN.- Press the <+> / <-> keys to increase or decrease the desired values.- The valid range is from 0 to 7.◆ Add VLAN- Press [Enter] to create a new VLAN or update an existing VLAN.◆ Configured VLAN List◆ Remove VLAN- Press [Enter] to remove an existing VLAN.

5-2-20 MAC IPv4 Network Configuration
GIGABYTE G493-ZB2 - 5-2-19 VLAN Configuration - 2

text_image Aptio Setup - AMI Advanced Configured [Disabled] Save Changes and Exit Indicate whether network address configured successfully or not. ++: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI
Parameter Description
ConfiguredIndicates whether network address is configured successfully or not. Options available: Enabled, Disabled. Default setting is Disabled.
Enable DHCP ^(Note) Options available: Enabled, Disabled. Default setting is Disabled.
Local IP Address ^(Note) Press [Enter] to configure local IP address.
Local NetMask ^(Note) Press [Enter] to configure local NetMask.
Local Gateway ^(Note) Press [Enter] to configure local Gateway
Local DNS Servers ^(Note) Press [Enter] to configure local DNS servers
Save Changes and Exit Press [Enter] to save all configurations.

(Note) This item appears when Configured is set to Enabled.

5-2-21 MAC IPv6 Network Configuration

GIGABYTE G493-ZB2 - 5-2-21 MAC IPv6 Network Configuration - 1

text_image Advanced Interface Name : etho Interface Type : Ethernet MAC address : D8-5E-D3-E3-F3-F3 Host addresses : FE80::DASE:D3FF:FEE3:F3F3/64 Route Table : FE80::/64 >>: Gateway addresses : DNS addresses : Interface ID DA:5E:D3:FF:FE:E3:F3:F3 DAD Transmit Count 1 Policy [automatic] Save Changes and Exit The 64 bit alternative Interface ID for the device. The string is colon separated. e.g. ff:dd:88:66:cc:1:2:3 ++: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI
ParameterDescription
Enter Configuration MenuPress [Enter] to configure advanced items.◆ Displays the MAC Address information.◆ Interface ID- The 64 bit alternative interface ID for the device. The string is colon separated. e.g. ff:dd:88:66:cc:1:2:3.◆ DAD Transmit Count- The number of consecutive Neighbor solicitation messages sent while performing Duplicate Address Detection on a tentative address. A value of zero indicates that Duplicate Address Detection is not performed.◆ Policy- Options available: automatic, manual. Default setting is automatic.◆ Save Changes and Exit- Press [Enter] to save all configurations.

5-3 AMD CBS Menu

AMD CBS menu displays submenu options for configuring the CPU-related information that the BIOS automatically sets. Select a submenu item, then press [Enter] to access the related submenu screen.

GIGABYTE G493-ZB2 - 5-3 AMD CBS Menu - 1

text_image Aptio Setup - AMI Main Advanced AMD CBS AMD PBS Option Chipset Server Hgmt Security Boot Save & Exit AMD CBS AMD CBS Revision Number 0x0 CPU Common Options DF Common Options UMC Common Options NBIO Common Options FCH Common Options Soc Miscellaneous Control Horkload Tuning CKL Common Options CPU Common Options ++: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI

5-3-1 CPU Common Options

GIGABYTE G493-ZB2 - 5-3-1 CPU Common Options - 1

text_image Aptio Setup - AMI AMD CBS CPU Common Options ▶ Performance REP-MOV/STOS Streaming [Enabled] ▶ Prefetcher settings ▶ Core Watchdog RedirectForReturnDis [Auto] Platform First Error Handling [Auto] Core Performance Boost [Auto] Global C-state Control [Auto] Power Supply Idle Control [Auto] SEV-ES ASID Space Limit 1 SEV Control [Enabled] Streaming Stores Control [Auto] Local APIC Mode [Auto] ACPI _CST C1 Declaration [Auto] ACPI CST C2 Latency 800 MCA error thresh enable [Auto] MCA FruText [True] SMU and PSP Debug Mode [Auto] PPIN Opt-in [Auto] SNP Memory (RMP Table) Coverage [Auto] SHEE [Auto] Action on BIST Failure [Auto] Performance ++: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI

GIGABYTE G493-ZB2 - 5-3-1 CPU Common Options - 2

text_image Aptio Setup - AMI AMD CBS Platform First Error Handling [Auto] Core Performance Boost [Auto] Global C-state Control [Auto] Power Supply Idle Control [Auto] SEV-ES ASID Space Limit 1 SEV Control [Enabled] Streaming Stores Control [Auto] Local APIC Mode [Auto] ACPI _CST C1 Declaration [Auto] ACPI CST C2 Latency 800 MCA error thresh enable [Auto] MCA FruText [True] SMU and PSP Debug Mode [Auto] PPIN Opt-in [Auto] SNP Memory (RMP Table) Coverage [Auto] SMEE [Auto] Action on BIST Failure [Auto] Enhanced REP MOVSB/STOSB (ERSM) [Auto] Log Transparent Errors [Auto] AVX512 [Auto] MONITOR and MWAIT disable [Auto] Small Hammer Configuration [Auto] Corrector Branch Predictor [Disabled] PAUSE Delay [Auto] CPU Speculative Store Modes [Auto] Balanced: Store instructions may delay sending out their invalidations to remote cacheline copies when the cacheline is present but not in a writable state in the local cache. More Speculative: Store instructions will send out invalidations to +: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI
Parameter Description
CPU Common Options
Performance Press [Enter] for configuration of advanced items.
REP-MOV/STOS StreamingAllow REP-MOV/STOS to use non-caching streaming stores for large sizes. Options available: Disabled, Enabled. Default setting is Enabled.
Prefetcher settings Press [Enter] for configuration of advanced items.
Core Watchdog Press [Enter] for configuration of advanced items.
RedirectForReturnDisFrom a workaround for GCC/C000005 issue for XV Core on CZ A0, setting MSRC001_1029 Decode Configuration (DE_CFG) bit 14 [DecfgNoRdrctForReturns] to 1. Options available: Auto, 1, 0. Default setting is Auto.
Platform First Error HandlingEnable/Disable PFEH, cloak individual banks, and mask deferred error interrupts from each bank. Options available: Enabled, Disabled, Auto. Default setting is Auto.
Core Performance BoostEnable/Disable the Core Performance Boost function. Options available: Disabled, Auto. Default setting is Auto.
Global C-state ControlControls the IO based C-state generation and DF C-states. Options available: Disabled, Enabled, Auto. Default setting is Auto.
Power Supply Idle ControlConfigures the Power Supply Idle Control. Options available: Low Current Idle, Typical Current Idle, Auto. Default setting is Auto.
SEV-ES ASID Space LimitConfigures the Space limit for SEV-ES ASIDs. Default setting is 1.
SEV ControlEnable/Disable SEV control. Options available: Enable, Disable. Default setting is Enable.
Streaming Stores ControlEnable/Disable the Streaming Stores functionality. Options available: Disabled, Enabled, Auto. Default setting is Auto.
Local APIC ModeSets the Local APIC Mode. Options available: Compatibility, xAPIC, x2APIC, Auto. Default setting is Auto.
ACPI_CST C1 DeclarationDetermines whether or not to declare the C1 state to the OS.. Options available: Disabled, Enabled, Auto. Default setting is Auto.
ACPI CST C2 Latency Enter a value for ACPI CST C2 Latency.
MCA error thresh enableEnable MCA error thresholding. Options available: False, True, Auto. Default setting is True.
MCA FruTextEnable MCA FruText. Options available: False, True. Default setting is True.
SMU and PSP Debug ModeWhen this option is enabled, specific uncorrected errors detected by the PSP FW or SMU FW will hand and not reset the system. Options available: Disabled, Enabled, Auto. Default setting is Auto.
PPIN Opt-inEnable/Disable the PPIN feature. Options available: Disabled, Enabled, Auto. Default setting is Auto.
SNP Memory (RMP Table)CoverageEnabled: Enter system memory is covered.Options available: Disabled, Enabled, Custom, Auto.Default setting isAuto.
SMEEControls the Secure Memory Encryption Enable (SMEE) function.Options available: Disable, Enable, Auto. Default setting isAuto.
Action on BIST FailureAction to take when a CCD BIST failure is detected.Options available: Do nothing, Down-CCD, Auto. Default setting isAuto.
Enhanced REP MOVSB/STOSB (ERMSB)Options available: Disabled, Enabled, Auto. Default setting isAuto.
Log Transparent ErrorsEnable/Disable the log Transparent errors function.Options available: Auto, Disabled, Enabled. Default setting isAuto.
AVX512Enable/Disable AVX512.Options available: Disabled, Enabled, Auto. Default setting isAuto.
MONITOR and MWAIT disableThe MONITOR, MWAIT, MONITORX and MWAITX opcodes become invalid when enabled.Options available: Enabled, Disabled, Auto. Default setting isAuto
Small Hammer ConfigurationOptions available: Disabled, Enabled, Auto. Default setting isAuto.
Corrector Branch Predictor Options available: Disable, Enable. Default setting isDisable.
PAUSE DelayNumber a cycles thread will be idle after a PAUSE instruction.Options available: Auto, Disable, 16 cycles, 32 cycles, 64 cycles, 128 cycles. Default setting isAuto.
CPU Speculative Store ModesSelect the CPU speculative store modes.Options available: Balanced, More Speculative, Less Speculative, Auto.Default setting isAuto.

5-3-1-1 Performance

GIGABYTE G493-ZB2 - 5-3-1-1 Performance - 1

text_image Aptio Setup - AMI AMD CBS Performance OC Mode [Normal Operation] ► Custom Core Pstates ► CDD/Core/Thread Enablement SMT Control [Disabled] Select overclock operation modes +: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI

Parameter Description

Performance
OC Mode ^(Note) Options available: Normal Operation, Customized. Default setting is Normal Operation.
Custom Core PstatesAllows you to accept or decline enabling Custom Core Pstates. When accepted, you can disable or customize core pstates.
CCD/Core/Thread EnablementAllows you to accept or decline enabling CCDs, processor cores and threads. When accepted, you can control the number of CCDs to be used, and the number of cores to be used.◆ CCD Control- Options available: Auto, 2 CCDs, 4 CCDs, 6 CCDs, 8 CCDs, 10 CCDs. Default setting is Auto.◆ Core Control- Options available: Auto, ONE(1+0), TWO(2+0), THREE(3+0), FOUR(4+0), FIVE(5+0), SIX(6+0), SEVEN(7+0).- Default setting is Auto.
SMT ControlCan be used to disable symmetric multithreading. To re-enable SMT, a POWER CYCLE is needed after select the 'Enable' option. Select 'Auto' base on BIOS PCD. (PcdAmdSmtMode) default setting.Options available: Disabled, Enabled, Auto. Default setting is Disabled.

(Note) Advanced items are configurable when this item is defined.

5-3-1-2 Prefetcher Settings

GIGABYTE G493-ZB2 - 5-3-1-2 Prefetcher Settings - 1

text_image Aptio Setup - AMI AND CBS Prefetcher settings L1 Stream HW Prefetcher [Auto] L1 Stride Prefetcher [Auto] L1 Region Prefetcher [Auto] L2 Stream HW Prefetcher [Auto] L2 Up/Down Prefetcher [Auto] L1 Burst Prefetch Mode [Auto] Option to Enable | Disable L1 Stream HW Prefetcher +: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI

Parameter Description

Prefetcher settings
L1 Stream HW PrefetcherEnable/Disable L1 Stream HW Prefetcher.Options available: Disabled, Enabled, Auto. Default setting isAuto.
L1 Stride PrefetcherUse memory access history of individual instructions to fetch additional lines when each access is a constant distance from the previous.Enable/Disable L1 Stride Prefetcher.Options available: Disabled, Enabled, Auto. Default setting isAuto.
L1 Region PrefetcherUse memory access history to fetch additional lines when the data access for a given instruction tends to be followed by other data accesses.Enable/Disable L1 Region Prefetcher.Options available: Disabled, Enabled, Auto. Default setting isAuto.
L2 Stream HW PrefetcherEnable/Disable L2 Stream HW Prefetcher.Options available: Disabled, Enabled, Auto. Default setting isAuto.
L2 Up/Down PrefetcherUse memory access history to determine whether to fetch the next or previous line for all memory accesses.Enable/Disable L2 Up/Down Prefetcher.Options available: Disabled, Enabled, Auto. Default setting isAuto.
L1 Burst Prefetch ModeEnable/Disable L1 Burst Prefetch Mode.Options available: Disabled, Enabled, Auto. Default setting isAuto.

5-3-1-3 Core Watchdog

GIGABYTE G493-ZB2 - 5-3-1-3 Core Watchdog - 1

text_image Aptio Setup - AMI AMD CBS Core Watchdog Core Watchdog Timer Enable [Auto] Enable or disable CPU Watchdog Timer +: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI

Parameter Description

Core Watchdog
Core Watchdog Timer Enable ^(Note) Enable/Disable CPU Watchdog Timer. Options available: Disabled, Enabled, Auto. Default setting isAuto.
Core Watchdog Timer IntervalSelect the CPU Watchdog Timer interval. Options available: 2.681s, 1.340s, 669.41ms, 334.05ms, 166.37ms, 82.53ms, 40.61ms, 20.970ms, 10.484ms,5.241ms, 2.620ms, 1.309ms, 654.08us, 326.4us, 162.56us, 80.64us, 39.68us, Auto. Default setting isAuto.
Core Watchdog Timer SeveritySpecify the CPU watch dog timer severity. Options available: No Error, Transparent, Corrected, Deferred, Uncorrected, Fatal, Auto. Default setting isAuto.

(Note) Advanced items prompt when this item is defined.

5-3-2 DF Common Options

GIGABYTE G493-ZB2 - 5-3-2 DF Common Options - 1

text_image Aptio Setup - AMI AMD CBS DF Common Options ► Memory Addressing ► ACPI ► Link ► SDCI ► Probe Filter DF Watchdog Timer Interval [Auto] Disable DF to external IP [Auto] SyncFloodPropagation Sync Flood Propagation to DF [Auto] Components Freeze DF module queues on error [Auto] CD5 memory region encryption [Auto] CCD B/W Balance Throttle Level [Auto] Memory Addressing +: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI
Parameter Description
DF Common Options
Memory Addressing Press [Enter] for configuration of advanced items.
ACPI Press [Enter] for configuration of advanced items.
Link Press [Enter] for configuration of advanced items.
SDCI Press [Enter] for configuration of advanced items.
Probe Filter Press [Enter] for configuration of advanced items.
DF Watchdog Timer IntervalConfigures the Data Fabric watchdog timer interval. Options available: Auto, 41ms, 166ms, 334ms, 669ms, 1.34 seconds, 2.68 seconds, 5.36 seconds. Default setting is Auto.
Disable DF to external IP sync flood propagationEnable/Disable SyncFlood to UMC & downstream slaves. Options available: Sync flood disabled, Sync flood enabled, Auto. Default setting is Auto.
Sync flood propagation to DF ComponentsEnable/Disable DF Sync Flood propagation. Options available: Sync flood disabled, Sync flood enabled, Auto. Default setting is Auto.
Freeze DF module queues on errorOptions available: Disabled, Enabled, Auto. Default setting is Auto.
CC6 memory region encryptionControls whether or not the CC6 save/restor memory is encrypted. Options available: Disabled, Enabled, Auto. Default setting is Auto.
CCD B/W Balance Throttle LevelOptions available: Auto, Level 0, Level 1, Level 2, Level 3, Level 4. Default setting is Auto.

5-3-2-1 Memory Addressing

GIGABYTE G493-ZB2 - 5-3-2-1 Memory Addressing - 1

text_image Aptio Setup - AMI AMD CBS Memory Addressing NUMA nodes per socket [Auto] Memory interleaving [Auto] 1TB remap [Auto] DRAM map inversion [Auto] Location of private memory regions [Auto] CXL Memory interleaving [Auto] CXL Sublink interleaving [Auto] Specifies the number of desired NUMA nodes per socket. Zero will attempt to interleave the two sockets together. ++: Select Screen 14: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit version 2.21.1279 Copyright (C) 2023 AMI
Parameter Description
Memory Addressing
NUMA nodes per socketSpecifies the number of desired NUMA nodes per socket.Options available: NPS0, NPS1, NPS2, NPS4, Auto. Default setting isAuto.NOTE!Available options may vary by system configuration.Only dual processor configuration supports NPS0.
Memory interleavingEnable/Disable the Memory interleaving feature.Options available: Disabled, Auto, Enabled. Default setting isAuto.
1TB remapEnable/Disable to remap DRAM out of the space just below the 1TB boundary.The ability to remap depends on DRAM configuration, NPS, and interleaving selection, and may not always be possible.Options available: Do not remap, Attempt to remap, Auto.Default setting isAuto.
DRAM map inversionEnable/Disable the DRAM map inversion function.Options available: Disabled, Enabled, Auto. Default setting isAuto.
Location of private memory regionsControls whether or not the private memory regions (PSP, SMU and CC6) are at the top of DRAM or distributed.Options available: Distributed, Consolidated, Auto. Default setting isAuto.
CXL Memory interleaving Options available: Disabled, Enabled, Auto. Default setting isAuto.
CXL Sublink interleaving Options available: Enable, Disable, Auto. Default setting isAuto.

5-3-2-2 ACPI

GIGABYTE G493-ZB2 - 5-3-2-2 ACPI - 1

text_image Aptio Setup - AMI AMD CBS ACPI ACPI SRAT L3 Cache As NUMA Domain [Auto] ACPI SLIT Distance Control [Auto] ACPI SLIT remote relative distance [Auto] Enabled: Each CCX in the system will be declared as a separate NUMA domain. Disabled: Memory Addressing \ NUMA nodes per socket will be declared. +: Select Screen +: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI

Parameter Description

ACPI
ACPI SRAT L3 Cache As NUMA DomainEnable/Disable report each L3 cache as a NUMA Domain to the OS. Options available: Disabled, Enabled, Auto. Default setting is Auto.
ACPI SLIT Distance ControlDetermines how the SLIT distances are declared. Options available: Manual, Auto. Default setting is Auto.
ACPI SLIT remote relative distanceSets the remote socket distance for 2P systems as near (2.8) or far (3.2). Options available: Near, Far, Auto. Default setting is Auto.

5-3-2-3 Link
GIGABYTE G493-ZB2 - 5-3-2-2 ACPI - 2

text_image Aptio Setup - AMI AMD CBS Link GMI encryption control [Auto] ×GMI encryption control [Auto] ×GMI Link Configuration [Auto] 4-link ×GMI max speed [Auto] 3-link ×GMI max speed [Auto] ×GMI 18GACOFC [Auto] ×GMI CRC Scale 7 ×GMI CRC Threshold 25 ×GMI Preset Control [Enabled] ×GMI Global Preset List ×GMI Initial Preset ×GMI TXEQ Search Mask ×GMI AC/DC Coupled Link ×GMI Channel Type Control GMI link encryption +: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI
Parameter Description
GMI encryption controlEnable/Disable GMI link encryption. Options available: Disabled, Enabled, Auto. Default setting is Auto.
xGMI encryption controlEnable/Disable xGMI link encryption. Options available: Disabled, Enabled, Auto. Default setting is Auto.
xGMI Link ConfigurationConfigures the number of xGMI2 links used on a multi-socket system. Options available: Auto, 3 xGMI Links, 4 xGMI Links. Default setting is Auto.
4-link xGMI max speedSpecifies the max speed of 4-link xGMI. Options available: 12Gbps, 16Gbps, 17Gbps, 18Gbps, 20Gbps, 22Gbps, 23Gbps, 24Gbps, 25Gbps, 26Gbps, 27Gbps, 30Gbps, 32Gbps, Auto. Default setting is Auto.
3-link xGMI max speedSpecifies the max speed of 3-link xGMI. Options available: 12Gbps, 16Gbps, 17Gbps, 18Gbps, 20Gbps, 22Gbps, 23Gbps, 24Gbps, 25Gbps, 26Gbps, 27Gbps, 30Gbps, 32Gbps, Auto. Default setting is Auto.
xGMI 18GACOFCConfigures xGMI 18GACOFC. Options available: Auto, Enable, Disable. Default setting is Auto.
xGMI CRC ScaleConfigures leaky bucket scale for xGMI and WAFL CRC errors. Every scale milliseconds an error will leak from the CRC counter. Default setting is 7.
xGMI CRC ThresholdConfigures leaky bucket threshold for xGMI and WAFL CRC errors. If link CRC counter exceeds this threshold, an error will be logged. Default setting is 25.
xGMI Preset ControlEnable/Disable xGMI Preset control. Options available: Disabled, Enabled, Auto. Default setting is Auto.

Parameter Description

xGMI Global Preset List Press [Enter] to configure the xGMI Preset list.
xGMI Initial Preset Press [Enter] to configure the xGMI Initial Preset CPU0/1 link.
xGMI TXEQ Search Mask Press [Enter] to configure the xGMI TXEQ Search Mask CPU0/1 link.
xGMI AC/DC Coupled LinkPress [Enter] to configure the xGMI AC/DC Coupled link.◆ xGMI AC/DC Coupled Link Control ^(Note) – Options available: Manual, Auto. Default setting isAuto.
xGMI Channel TypePress [Enter] to configure the xGMI Channel Type.◆ xGMI Channel Type Control ^(Note) – Options available: Manual, Auto. Default setting isAuto.

(Note) Advanced items prompt when this item is defined.

5-3-2-4 SDCI
GIGABYTE G493-ZB2 - 5-3-2-2 ACPI - 3

text_image Aptio Setup - AMI AMD CBS SDCI SDCI [Auto] DisRmtSteep [Auto] Enable or Disable Smart Data Cache Injection feature +: Select Screen 1↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI

Parameter Description

SDCI ^(Note)

Options available: Disabled, Enabled, Auto. Default setting is Auto.

DisRmSteer Options available: Disabled, Enabled, Auto. Default setting is Auto.

(Note) Advanced items prompt when this item is defined.

5-3-2-5 Probe Filter

GIGABYTE G493-ZB2 - 5-3-2-5 Probe Filter - 1

text_image Aptio Setup - AMI AMD CBS Probe Filter Organization [Dedicated] Periodic Directory Rinse (PDR) [Auto] Tuning Specifies whether multiple memory/CXL channels will share probe filter storage. For memory sizes of 16TB or larger, this feature is ignored as it is auto-selected to 'shared' +: Select Screen +: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI
Parameter Description
OrganizationSpecifies whether multiple memory/CXL channels will share probe filter storage. Options available: Auto, Dedicated, Shared. Default setting is Dedicated.
Periodic Directory Rinse (PDR) TuningControls PDR settings that may impact performance by workload and/or processor. Options available: Memory-Sensitive, Cache-Bound, Neutral, Auto. Default setting is Auto.

5-3-3 UMC Common Options

GIGABYTE G493-ZB2 - 5-3-3 UMC Common Options - 1

text_image Aptio Setup - AMI AMD CBS UMC Common Options DDR Addressing Options DDR Controller Configuration DDR MBIST Options DDR RAS DDR Bus Configuration Enforce POR DDR Training Options DDR Security DDR PMIC Configuration DDR Miscellaneous DDR PHY (CMN) DDR Addressing Options +: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI

Parameter Description

UMC Common Options

DDR Addressing Options Press [Enter] for configuration of advanced items.

DDR Controller Configuration Press [Enter] for configuration of advanced items.

DDR MBIST Options Press [Enter] for configuration of advanced items.

DDR RAS Press [Enter] for configuration of advanced items.

DDR Bus Configuration Press [Enter] for configuration of advanced items.

Enforce POR Press [Enter] for configuration of advanced items.

DDR Training Options Press [Enter] for configuration of advanced items.

DDR Security Press [Enter] for configuration of advanced items.

DDR PMIC Configuration Press [Enter] for configuration of advanced items.

DDR Miscellaneous Press [Enter] for configuration of advanced items.

DDR PHY (CMN) Press [Enter] for configuration of advanced items.

5-3-3-1 DDR Addressing Options

GIGABYTE G493-ZB2 - 5-3-3-1 DDR Addressing Options - 1

text_image Aptio Setup - AMI AMD CBS DDR Addressing Options Chipselect Interleaving [Auto] Address Hash Bank [Auto] Address Hash CS [Auto] Address Hash Subchannel [Auto] Bank SwapMode [Auto] Interleave memory blocks across the DRAM chip selects for node 0. ++: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI
Parameter Description
DDR Addressing Options
Chipselect InterleavingInterleaves memory blocks across the DRAM chip selects for node 0. Options available: Disabled, Auto. Default setting is Auto.
Address Hash BankEnable or disable bank addressing hashing. Options available: Disabled, Enabled, Auto. Default setting is Auto.
Address Hash CSEnable or disable CS addressing hashing. Options available: Auto, Enabled, Disabled. Default setting is Auto.
Address Hash SubchannelEnable or disable sub-channel addressing hashing. Options available: Auto, Enabled, Disabled. Default setting is Auto.
BankSwapMode Options available: Auto, Disabled, Swap CPU. Default setting is Auto.

5-3-3-2 DDR Controller Configuration

GIGABYTE G493-ZB2 - 5-3-3-2 DDR Controller Configuration - 1

text_image Aptio Setup - AMI AND CBS DDR Controller Configuration ▶ DDR Power Options ▶ Memory Channel Disable ▶ Refresh Management (RFM) DDR Power Options ++: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI

Parameter Description

DDR Controller Configuration

DDR Power Options Press [Enter] for configuration of advanced items.

Memory Channel Disable Press [Enter] for configuration of advanced items.

Refresh Management (RFM) Press [Enter] for configuration of advanced items.

5-3-3-2-1 DDR Power Options

GIGABYTE G493-ZB2 - 5-3-3-2-1 DDR Power Options - 1

text_image Aptio Setup - AMI AMD CBS DDR Power Options Power Down Enable [Auto] Sub Urgent Refresh Lower Bound 1 Urgent Refresh Limit 4 DRAM Refresh Rate [3.9 usec] Self-Refresh Exit Staggering [n = 9] Enable or disable DDR power down mode ++: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI
Parameter Description
DDR Power Options
Power Down EnableEnable or disable DDR power down mode. Options available: Disabled, Enabled, Auto. Default setting is Auto.
Sub Urgent Refresh Lower BoundSpecifies the stored refresh limit required to enter sub-urgent refresh mode.
Urgent Refresh Limit Specifies the stored refresh limit required to enter urgent refresh mode.
DRAM Refresh RateDRAM refresh rate: 1.95us or 3.9us. Options available: 3.9 usec, 1.95usec. Default setting is 3.9 usec.
Self-Refresh Exit Staggering Options available: Disabled, n=1~9. Default setting is n=9.

5-3-3-2-2 Memory Channel Disable

GIGABYTE G493-ZB2 - 5-3-3-2-2 Memory Channel Disable - 1

text_image Aptio Setup - AMI AMD CBS Memory Channel Disable Memory Channel Disable Bitmask 0 CPU 0 Channel A [Enabled] CPU 0 Channel B [Enabled] CPU 0 Channel C [Enabled] CPU 0 Channel D [Enabled] CPU 0 Channel E [Enabled] CPU 0 Channel F [Enabled] CPU 0 Channel G [Enabled] CPU 0 Channel H [Enabled] CPU 0 Channel I [Enabled] CPU 0 Channel J [Enabled] CPU 0 Channel K [Enabled] CPU 0 Channel L [Enabled] CPU 1 Channel M [Enabled] CPU 1 Channel N [Enabled] CPU 1 Channel O [Enabled] CPU 1 Channel P [Enabled] CPU 1 Channel Q [Enabled] CPU 1 Channel R [Enabled] CPU 1 Channel S [Enabled] CPU 1 Channel T [Enabled] CPU 1 Channel U [Enabled] CPU 1 Channel V [Enabled] SPD reading will be skipped when channel is disabled. +: Select Screen +: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI

Parameter Description

Memory Channel Disable

Memory Channel Disable Bitmask

CPU0/1 Channel_# Press [Enter] to enable/disable specific memory channel.

5-3-3-2-3 Refresh Management (RFM)
GIGABYTE G493-ZB2 - Parameter Description - 1

text_image Aptio Setup - AMI AMD CBS Refresh Management (RFM) Refresh Management [Auto] RAA Initial Management Threshold [Auto] RAA Maximum Management Threshold [Auto] RAA Refresh Decrement Multiplier [Auto] Auto: Disable Disable: Disable RFM for all Ranks. Enable: Enable RFM for Ranks which support RFM. Force Enable: Enable RFM for all Ranks regardless of support. Selecting 'Force Enable' will cause REFpb/REFsb to be disabled if all ranks +: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI

Parameter Description

Refresh Management (RFM)
Refresh ManagementConfigure Refresh Management. Options available: Enabled, Disabled, Auto, Force Enable. Default setting is Auto.
RAA Initial Management ThresholdOverride Rolling Accumulated ACT Initial Management Threshold. Options available: 32, 40, 48, 56, 64, 72, 80, Auto. Default setting is Auto.
RAA Maximum Management ThresholdOverride Rolling Accumulated ACT Maximum Management Threshold. Options available: 3X, 4X, 5X, 6X, Auto. Default setting is Auto.
RAA Refresh Decrement MultiplierOverride RAA Refresh Decrement Multiplier. Options available: 0.5, 1, Auto. Default setting is Auto.

5-3-3-3 DDR MBIST Options

GIGABYTE G493-ZB2 - 5-3-3-3 DDR MBIST Options - 1

text_image Aptio Setup - AMI AMD CBS DDR MBIST Options MBIST Enable [Auto] MBIST Test Mode [Auto] MBIST Aggressors [Auto] MBIST Per Bit Slave Die Reporting [Auto] ► Data Eye DDR Healing BIST [Disabled] DDR Healing BIST Execution Mode [One Time] ► PMU Mem BIST Algorithm DDR Healing BIST Repair Type [Soft Repair] Enable or disable Memory MBIST +: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI
Parameter Description
DDR MBIST Options
MBIST EnableEnable/Disable the Memory MBIST function.Options available: Disabled, Enabled, Auto. Default setting isAuto.
MBIST Test Mode ^(Note1) Selects MBIST Test Mode.Interface Mode: Tests Single and Multiple CS transactions and Basic Connectivity.Data Eye Mode: Measures Voltage vs. Timing.Options available: Auto, Both, Interface Mode, Data Eye Mode. Default setting isAuto.
MBIST Aggressors ^(Note1) Enable/Disable MBIST Aggressor test.Options available: Auto, Enabled, Disabled. Default setting isAuto.
MBIST Per Bit Slave Die Reporting ^(Note1) Enable/Disable to report 2D data eye results in ABL log for each DQ, Chipselect, and Channel.Options available: Auto, Enabled, Disabled. Default setting isAuto.
Data EyePress [Enter] to configure advanced items.
Memory Healing BISTEnable/Disable memory healing BIST.Options available: Disabled, PMU Mem BIST, Self-Healing Mem BIST, PMU and Self-Healing Mem BIST. Default setting isDisabled.

(Note1) This item is available when MBIST Enable is set to Enabled.

Parameter Description
DDR Healing BIST Execution Mode ^(Note2) Options available: One Time, Every boot.Default setting isOne Time.
PMU Mem BIST Algorithm ^(Note2) Press [Enter] to enable/disable PMU Mem BIST Algorithm.
DDR Healing BIST Repair Type ^(Note2) For DRAM errors found in the BIOS memory BIST select the repair type.Options available: Soft Repair, Hard Repair, No Repairs -Test only. Default setting isSoft Repair.

(Note2) This item appears when DDR Healing BIST is defined.

5-3-3-3-1 Data Eye

GIGABYTE G493-ZB2 - 5-3-3-3-1 Data Eye - 1

text_image Aptio Setup - AMI AMD CBS Data Eye Pattern Select [PRBS] Pattern Length 3 Aggressor Channel [All Channels] Aggressor Static Lane Control [Disabled] Aggressor Static Lane Select 0 Upper 32 bits Aggressor Static Lane Select 0 Lower 32 Bits Aggressor Static Lane Select ECC 0 Aggressor Static Lane Value 0 Target Static Lane Control [Disabled] Target Static Lane Select Upper 0 32 bit Target Static Lane Select Lower 0 32 Bits Target Static Lane Select ECC 0 Target Static Lane Value 0 Worst Case Margin Granularity [Per Chip Select] Read Voltage Sweep Step Size [1] Read Timing Sweep Step Size [1] Write Voltage Sweep Step Size [1] Write Timing Sweep Step Size [1] Silent Execution [Disabled] MBIST Data Eye Pattern Type. 0 - PRBS (default), 1 - SSO, 2 - Both +: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI
ParameterDescription
Data Eye
Pattern SelectOptions available: PRBS, SSO, Both. Default setting is PRBS.
Pattern LengthDetermines the pattern length. The possible options are N=3....12.
Aggressor ChannelThis item helps read the aggressors channels. Options available: One Sub-Channel, Half Channels, All Channels. Default setting is All Channels.
Aggressor Static Lane ControlEnable/Disable the Aggressor Static Lane Control function. Options available: Enabled, Disabled. Default setting is Disabled.
Aggressor Static Lane Select Upper 32 bitsThis item is configurable when Aggressor Static Lane Control is set to Enabled.
Aggressor Static Lane Select Lower 32 bitsThis item is configurable when Aggressor Static Lane Control is set to Enabled.
Aggressor Static Lane Select ECCThis item is configurable when Aggressor Static Lane Control is set to Enabled.
Aggressor Static Lane ValueThis item is configurable when Aggressor Static Lane Control is set to Enabled.
Target Static Lane ControlEnable/Disable the Target Static Lane Control function. Options available: Enabled, Disabled. Default setting is Disabled.
Target Static Lane Select Upper 32 bitsThis item is configurable when Target Static Lane Control is set to Enabled.
Target Static Lane Select Lower 32 bitsThis item is configurable when Target Static Lane Control is set to Enabled.
Target Static Lane Select ECCThis item is configurable when Target Static Lane Control is set to Enabled.
Target Static Lane ValueThis item is configurable when Target Static Lane Control is set to Enabled.
Worst Case Margin GranularityConfigures Worst Case Margin Granularity.Options available: Per Chip Select, Per Nibble.Default setting is Per Chip Select.
Read Voltage Sweep Step SizeConfigures the step size for read Data Eye voltage sweep.Options available: 1, 2, 4. Default setting is 1.
Read Timing Sweep Step SizeConfigures the step size for read Data Eye timing sweep.Options available: 1, 2, 4. Default setting is 1.
Write Voltage Sweep Step SizeConfigures the step size for write Data Eye voltage sweep.Options available: 1, 2, 4. Default setting is 1.
Write Timing Sweep Step SizeConfigures the step size for write Data Eye timing sweep.Options available: 1, 2, 4. Default setting is 1.
Silent ExecutionExecute MBIST Data Eye silently without ABL log output.Options available: Enabled, Disabled. Default setting is Disabled.

5-3-3-4 DDR RAS

GIGABYTE G493-ZB2 - 5-3-3-4 DDR RAS - 1

text_image Aptio Setup - AMI AMD CBS DDR RAS Data Poisoning [Auto] DRAM Boot Time Post Package Repair [Disabled] DRAM Runtime Post Package Repair [Disabled] RCD Parity [Enabled] Max RCD Parity Error Replay 8 Disable Memory Error Injection [Auto] ▶ECC Configuration ▶DRAM Scrubbers DRAM Corrected Error Counter [LeakMode] Enable DRAM Corrected Error Counter [True] Interrupt Enable DRAM Corrected Error Counter Leak 7 Rate DRAM Corrected Error Counter FFF5 Start Count Enable poison data creation on uncorrectable DDR DRAM ECC errors and poison propagation to CPU cores and caches. Requires ECC memory. When FALSE, a fatal error event will occur on DDR ECC errors sets UMC_CH::EccCtrl[UcFatalEn] when ++: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI

Parameter Description

DDR RAS
Data PoisoningEnable/Disable the Data Poisoning function. Options available: Auto, Enabled, Disabled. Default setting is Auto.
DRAM Boot Time Post Package RepairEnable/Disable the DRAM Boot Time Post Package Repair function. Options available: Enabled, Disabled. Default setting is Disabled.
DRAM Runtime Post Package RepairEnable/Disable the DRAM Runtime Post Package Repair function. Options available: Enabled, Disabled. Default setting is Disabled.
RCD ParityEnable/Disable the RCD Parity function. Options available: Auto, Enabled, Disabled. Default setting is Enabled.

Max RCD Parity Error Replay Default setting is 8.

Disable Memory Error Injection Options available: False, True, Auto. Default setting is Auto.

ECC ConfigurationPress [Enter] to configure advanced items.◆ DRAM ECC Symbol Size– Configures the DRAM ECC Symbol Size.– Options available: Auto, x4, x16. Default setting isAuto.◆ DRAM ECC Enable– Enable/Disable DRAM ECC. When set to Auto, it will set ECC to enable.– Options available: Auto, Enabled, Disabled. Default setting isAuto.

Parameter Description

ECC Configuration(continued)DRAM UECC Retry- Enable/Disable DRAM UECC Retry.- Options available: Auto, Enabled, Disabled. Default setting is Disabled.Max DRAM UECC Error Replay ^(Note) - Default setting is 8.Memory Clear- Options available: Auto, Enabled, Disabled. Default setting is Auto.Address XDR after ECC- Options available: Auto, Enabled, Disabled. Default setting is Disabled.
DRAM ScrubbersPress [Enter] to configure advanced items.DRAM ECS Mode- Options available: Auto, AutoECS, ManualECS, DisableECS. Default setting isAuto.DRAM Redirect Scrubber Enable- Options available: Auto, Enabled, Disabled. Default setting isAuto.DRAM Scrub Redirection Limit- Options available: Auto, 8 Scrubs, 4 Scrubs, 2 Scrubs, 1 Scrub. Default setting isAuto.DRAM Scrub Time- Options available: Disabled, 1 hour, 4 hours, 6 hours, 8 hours, 12 hours, 16 hours, 24 hours, 48 hours. Default setting is24 Hours.DRAM Error Threshold Count- Options available: Auto, ETC_4, ETC_16, ETC_64, ETC_256, ETC_1024, ETC_4096. Default setting isAuto.DRAM ECS Count Mode- Options available: Auto, Row Count Mode, Code Word Count Mode. Default setting isAuto.DRAM AutoEcs during Self Refresh- Options available: Auto, AutoEcs Disabled, AutoEcs Enabled. Default setting isAuto.DRAM ECS WriteBack Suppression- Options available: Auto, Enable, Disable. Default setting isAuto.DRAM X4 WriteBack Suppression- Options available: Auto, Enable, Disable. Default setting isAuto.

(Note) This item is available when DRAM UECC Retry is set to Enabled.

Parameter Description
DRAM Corrected Error Counter EnableConfigure DRAM Corrected Error Counter function.Options available: Disable, NoLeakMode, Leak Mode. Default setting is Leak Mode.
DRAM Corrected Error Counter Interrupt EnableEnable SMI when DRAM corrected Error Counter count exceeds the threshold value.Options available: False, True. Default setting is True.
DRAM Corrected Counter Leak RateProgram Rate value for DRAM Corrected Error Counter function. Default setting is 7.
DRAM Corrected Error Counter Start CountProgram starting value for DRAM Corrected Error Counter function. Default setting is FFF5.

5-3-3-5 DDR Bus Configuration

GIGABYTE G493-ZB2 - 5-3-3-5 DDR Bus Configuration - 1

text_image Aptio Setup - AMI AMD CBS DDR Bus Configuration Dram ODT Impedance RTT_NOM_WR [Auto] Dram ODT Impedance RTT_NOM_RD [Auto] Dram ODT impedance RTT_WR [Auto] Dram ODT impedance RTT_PARK [Auto] Dram ODT impedance DQS_RTT_PARK [Auto] Processor ODT impedance [Auto] Dram DQ drive strengths [Auto] Select the DRAMs On-die Termination impedance for RTT_NOM_WR +: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI
Parameter Description
DDR Bus Configuration
Dram ODT impedance RTT_NOM_WRSelect the DRAMs On-die Termination impedance for RTT_NOM_WR. Options available: Auto, RTT_OFF, RZQ (240), RZQ/2 (120), RZQ/3 (80) RZQ/4 (60), RZQ/5(48), RZQ/6(40), RZQ/7(34). Default setting is Auto.
Dram ODT impedance RTT_NOM_RDSelect the DRAMs On-die Termination impedance for RTT_NOM_RD. Options available: Auto, RTT_OFF, RZQ (240), RZQ/2 (120), RZQ/3 (80) RZQ/4 (60), RZQ/5(48), RZQ/6(40), RZQ/7(34). Default setting is Auto.
Dram ODT impedance RTT_WRSelect the DRAMs On-die Termination impedance for RTT_WR. Options available: Auto, RTT_OFF, RZQ (240), RZQ/2 (120), RZQ/3 (80) RZQ/4 (60), RZQ/5(48), RZQ/6(40), RZQ/7(34). Default setting is Auto.
Dram ODT impedance RTT_PARKSelect the DRAMs On-die Termination impedance for RTT_PARK. Options available: Auto, RTT_OFF, RZQ (240), RZQ/2 (120), RZQ/3 (80) RZQ/4 (60), RZQ/5(48), RZQ/6(40), RZQ/7(34). Default setting is Auto.
Dram ODT impedance DQS_RTT_PARKSelect the DRAMs On-die Termination impedance for DQS_RTT_PARK. Options available: Auto, RTT_OFF, RZQ (240), RZQ/2 (120), RZQ/3 (80) RZQ/4 (60), RZQ/5(48), RZQ/6(40), RZQ/7(34). Default setting is Auto.

Parameter Description

Processor ODT impedanceSelect the ODT impedance for all DBYTE IOs. Options available: Auto, High Impedance, 480 ohm, 240 ohm, 160 ohm, 120 ohm, 96 ohm, 80 ohm, 68.6 ohm, 60 ohm, 53.3 ohm,48 ohm, 43.6 ohm, 40 ohm, 36.9 ohm, 34.3 ohm, 32 ohm, 30 ohm, 28.2 ohm, 26.7 ohm, 25.3 ohm. Default setting isAuto.
Dram DQ drive strengthsSelect the Dram Pull-up and Pull-Down Output Driver Impedance for all DQ and DMI IOs.. Options available: Auto, 48 ohm, 40 ohm, 34 ohm, Default setting isAuto.

5-3-3-6 Enforce POR

Aptio Setup - AMI AMD CDS
Enforce POR WARNING - DAMAGE CAUSED BY USE OF YOUR AMD PROCESSOR OUTSIDE OF SPECIFICATION OR IN EXCESS OF FACTORY SETTINGS ARE NOT COVERED UNDER YOUR AMD PRODUCT WARRANTY AND MAY NOT BE COVERED BY YOUR SYSTEM MANUFACTURER'S WARRANTY. Operating your AMD processor outside of specification or in excess of factory settings, including but not limited to overclocking, may damage or shorten the life of your processor or other system components, create system instabilities (e.g., data loss and corrupted images) and in extreme cases may result in total system failure. AMD does not provide support or service for issues or damages related to use of an AMD processor outside of processor specifications or in excess of factory settings. ► Decline ► AcceptDecline
+: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit

Parameter Description

Enforce POR Decline/Accept to configure the advanced items.

Accept

Active Memory Timing Settings ^(Note) Active memory Timing Settings. Options available: Auto, Enabled. Default setting isAuto.
Memory Target SpeedSpecifies the memory target speed in MT/s. Options available: Auto, DDR3200, DDR3600, DDR4000, DDR4400, DDR4800, DDR5200, DDR5600. Default setting isAuto.

SPD Timing Press [Enter] to configure advanced items.

Non-SPD Timing Press [Enter] to configure advanced items.

(Note) Advanced items prompt when this item is defined.

5-3-3-7 DDR Training Options

GIGABYTE G493-ZB2 - 5-3-3-7 DDR Training Options - 1

text_image Aptio Setup - AMI AMD CBS DDR Training Options DRAM PDA Enumerate ID Programming [Auto] Mode Specify PDA enumeration mode Auto : default 0 : Continuous DQS toggling PDA enumeration mode (default) 1 : Legacy PDA enumeration mode +: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI
Parameter Description
DDR Training Options
DRAM PDA Enumerate ID Programming ModeSpecify PDA enumeration mode. Options available: Auto, Toggling PDA enumeration mode, Legacy PDA enumeration mode. Default setting isAuto.

5-3-3-8 DDR Security

GIGABYTE G493-ZB2 - 5-3-3-8 DDR Security - 1

text_image Aptio Setup - AMI AMD CBS DDR Security TSME [Auto] AES [AES-256] Data Scramble [Enabled] SME-MK [Disabled] Transparent SME ++: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI

Parameter Description

Security
TSMEEnable/Disable Transparent SME. Options available: Auto, Enabled, Disabled. Default setting is Auto.
AES Options available: AES-128, AES-256. Default setting is AES-256.
Data ScrambleEnable/Disable Data Scrambling. Options available: Enabled, Disabled. Default setting is Enabled.
SME-MK Options available: Enabled, Disabled. Default setting is Disabled.

5-3-3-9 DDR PMIC Configuration

GIGABYTE G493-ZB2 - 5-3-3-9 DDR PMIC Configuration - 1

text_image Aptio Setup - AMI AMD CBS DDR PMIC Configuration PMIC Error Reporting [Auto] PMIC Operation Mode [Programmable Mode] PMIC Fault Recovery [Always] PMIC SWC VDDIO 1100 PMIC SWR/SWB VDD Core 1100 PMIC Stagger Delay 5 Max PMIC Power On FF Enables support for PMIC Error Reporting. ++: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI
Parameter Description
DDR PMIC Configuration
PMIC Error ReportingEnables support for PMIC Error Reporting. Options available: Auto, False, True. Default setting is Auto.
PMIC Operation ModeOptions available: Secure Mode, Programmable Mode. Default setting is Programmable Mode.
PMIC Fault Recovery Options available: Always, Never, Once. Default setting is Always.
PMIC SWC VDDIO Default setting is 1100.
PMIC SWA/SWB VDD Core Default setting is 1100.
PMIC Stagger Delay Default setting is 5.
Max PMIC Power On Default setting is FF.

5-3-3-10 DDR Miscellaneous

GIGABYTE G493-ZB2 - 5-3-3-10 DDR Miscellaneous - 1

text_image Aptio Setup - AMI AMD CBS DDR Miscellaneous DRAM Survives Warm Reset [Disabled] DOTS CMD Throttle Threshold [ > 85' C] 1 - Enabled (default); 0 - Disabled If enabled - Upon warm reset DRAM content is preserved, Training values are saved & retrieved. ++: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI

Parameter Description

DDR Miscellaneous

DRAM Survives Warm Reset Options available: Enabled, Disabled. Default setting is Enabled.

ODTS CMD Throttle Threshold Options available: >85'C, >90'C, >95'C. Default setting is >85'C.

5-3-3-11 DDR PHY (CMN)
GIGABYTE G493-ZB2 - Parameter Description - 1

text_image Aptio Setup - AMI AMD CBS DOR PHY (CMN) Periodic Training [Auto] Specifies Periodic Training config +: Select Screen 14: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI

Parameter Description

DDR PHY (CMN)
Periodic Training(Note)Options available: Auto, Enabled, Disabled. Default setting is Auto.
Periodic Training Interval Specifies the Periodic Training interval in millisecond.

(Note) Advanced items prompt when this item is defined.

5-3-4 NBIO Common Options

GIGABYTE G493-ZB2 - 5-3-4 NBIO Common Options - 1

text_image Aptio Setup - AMI AMD CBS NBIO Common Options Enable/Disable IOMMU IOMMU [Disabled] DMAr Support [Auto] DMA Protection [Auto] DRTM Virtual Device Support [Auto] DRTM Memory Reservation [Auto] ACS Enable [Auto] PCIe ARI Support [Auto] PCIe ARI Enumeration [Auto] PCIe Ten Bit Tag Support [Auto] ► SHU Common Options ► NBIO RAS Common Options Enable AER Cap [Enabled] Early Link Speed [Auto] Hot Plug Handling mode [Auto] Hot Plug Allow FF in Synchronous [Disabled] Presence Detect Select mode [Auto] Data Link Feature Cap [Auto] CV test [Auto] SEV-SNP Support [Auto] Allow Compliance [Auto] SRIS [Auto] Multi Upstream Auto Speed Change [Auto] ++: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI

GIGABYTE G493-ZB2 - 5-3-4 NBIO Common Options - 2

text_image Aptio Setup - AMI AMD CBS ACS Enable [Auto] PCIe ARI Support [Auto] PCIe ARI Enumeration [Auto] PCIe Ten Bit Tag Support [Auto] ► SMU Common Options ► NBIO RAS Common Options Enable AER Cap [Enabled] Early Link Speed [Auto] Hot Plug Handling mode [Auto] Hot Plug Allow FF in Synchronous [Disabled] Presence Detect Select mode [Auto] Data Link Feature Cap [Auto] CV test [Auto] SEV-SNP Support [Auto] Allow Compliance [Auto] SRIS [Auto] Multi Upstream Auto Speed Change [Auto] Multi Auto Speed Change On Last [Auto] Rate PCIE Link Speed Capability [Auto] RTM Margining Support [Auto] EQ Bypass To Highest Rate [Auto] Non-PCIe Compliant Support [Auto] ► nBif Common Options ► Link EQ Preset Options Link EQ Preset Options +: Select Screen ↑: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI
ParameterDescription
NBIO Common Options
IOMMUEnable/Disable the IOMMU function.Options available: Disabled, Enabled. Default setting isDisabled.
DMAr SupportEnable/Disable DMAr system protection during POST.Options available: Disabled, Enabled, Auto. Default setting isAuto.
DMA ProtectionEnable/Disable DMA remap support in IVRS IVinfo Field.Options available: Auto, Enabled, Disabled. Default setting isAuto.
DRTM Virtual DeviceSupportEnable/Disable DRTM ACPI virtual device.Options available: Disabled, Enabled, Auto. Default setting isAuto.
DRTM MemoryReservationEnable/Disable DRTM Memory reservation.Options available: Disabled, Enabled, Auto. Default setting isAuto.
ACS EnableEnable/Disable ACS.Options available: Enable, Disabled, Auto. Default setting isAuto.
PCIe ARI SupportEnable/Disable Alternative Routing-ID Interpretation.Options available: Disable, Enable, Auto. Default setting isAuto.
PCIe ARI EnumerationARI Forwarding Enable for each downstream port.Options available: Disable, Enable, Auto. Default setting isAuto.
PCIe Ten Bit Tag SupportEnable/Disable PCIe ten bit tags for supported devices. (Auto=Disabled)Options available: Disable, Enable, Auto. Default setting isAuto.
SMU Common Options Press [Enter] for configuration of advanced items.
NBIO RAS CommonOptionsPress [Enter] for configuration of advanced items.
Enable AER CapEnable/Disable Advanced Error Reporting Capability.Options available: Enable, Disabled, Auto. Default setting isAuto.
Early Link SpeedConfigures Early Link Speed.Options available: Auto, Gen1, Gen2. Default setting isAuto.
Hot Plug Handling modeControls the Hot Plug Handling mode.Options available: OS First, Firmware First/EDR if OS supports, FirmwareFirst but allow OS First, System Firmware Intermediary, Auto. Default settingisAuto.
Hot Plug Allow FF inSynchronousAllows firmware first hot plug handling mode to operate in mode A and modeB synchronous mappings.Options available: Disabled, Enabled. Default setting isDisabled.
Presence Detect SelectmodeControls the Presence Detect Select mode.Options available: OR, AND, Auto. Default setting isAuto.
Data Link Feature CapEnable/Disable the data link feature capability.Options available: Enabled, Disabled, Auto. Default setting isAuto.
CV testEnable/Disable the running PCIE CV tool support.Options available: Auto, Enabled, Disabled. Default setting isAuto.
SEV-SNP SupportEnable/Disable the SEV-SNP support.Options available: Disable, Enable. Default setting isDisable.
Allow ComplianceWhen enabled, allows the PCIe RP to enter Polling.Compliance state.Options available: Auto, Disable, Enable. Default setting isAuto.
SRIS Options available: Auto, Disable, Enable. Default setting isAuto.
Multi Upstream Auto Speed ChangeDefines the setting of this feature for all PCIe devices.Options available: Disabled, Enabled, Auto. Default setting isAuto.
Multi Auto Speed Change On Last RateOptions available: Disable, Enable, Auto. Default setting isAuto.
PCIE Link Speed CapabilityOptions available: Maximum speed, Gen1, Gen2, Gen3, Gen4, Gen5, Auto.Default setting isAuto.
RTM Margining Support Options available: Disable, Enable, Auto. Default setting isAuto.
EQ Bypass To Highest RateOptions available: Disable, Enable, Auto. Default setting isAuto.
Non-PCIe Compliant SupportOptions available: Disable, Enable, Auto. Default setting isAuto.
nBif Common Options Press [Enter] for configuration of advanced items.
Link EQ Preset Options Press [Enter] for configuration of advanced items.

5-3-4-1 SMU Common Options

GIGABYTE G493-ZB2 - 5-3-4-1 SMU Common Options - 1

text_image Aptio Setup - AMI AMD CBS SMU Common Options TDP Control [Auto] PPT Control [Auto] Determinism Control [Auto] xGMI Link Width Control [Auto] APBOIS [Auto] DfPstate Range Support [Auto] Power Profile Selection [High Performance Mode] BoostFmaxEn [Auto] DF PState Frequency Optimizer [Auto] DF Cstates [Auto] CPPC [Auto] HSMP Support [Auto] SVI3 SVC Speed Control [Auto] 3D V-Cache [Auto] Diagnostic Mode [Auto] PCIE Speed PMM Control [Auto] Auto = Use the fused TDP Manual = User can set customized TDP +: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI
ParameterDescription
SMU Common Options
TDP ControlOptions available: Manual, Auto. Default setting is Auto.
PPT ControlOptions available: Manual, Auto. Default setting is Auto.
Determinism ControlSelects use the fused Determinism or set customized Determinism. Options available: Manual, Auto. Default setting is Auto.
xGMI Link Width Control Options available: Manual, Auto. Default setting is Auto.
APBDIS Options available: 0, 1, Auto. Default setting is Auto.
Power Profile SelectionOptions available: High Performance Mode, Efficiency Mode, Maximum IO Performance Mode. Default setting is High Performance Mode.
BoostFmaxEn Options available: Manual, Auto. Default setting is Auto.
DF PState Frequency OptimizerOptions available: Auto, Enabled, Disabled. Default setting is Auto.
DF Cstates Options available: Disabled, Enabled, Auto. Default setting is Disabled.
CPPCEnable/Disable the CPPC feature. Options available: Disabled, Enabled, Auto. Default setting is Auto.
HSMP SupportEnable/Disable the HSMP support. Options available: Disabled, Enabled, Auto. Default setting is Auto.
SVI3 SVC Speed Control Options available: Auto, Manual. Default setting is Auto.
3D V-CacheOptions available: Auto, Disable, 1 stack, 2 stack, 4 stack.Default setting is Auto.
Diagnostic Mode Options available: Disabled, Enabled, Auto. Default setting is Auto.
PCIE Speed PMM ControlOptions available: Dynamic link speed determined by Power Management functionality, Static Target Link Speed (GEN4),Static Target Link Speed (GEN5),Auto. Default setting is Auto.

5-3-4-2 NBIO RAS Common Options

GIGABYTE G493-ZB2 - 5-3-4-2 NBIO RAS Common Options - 1

text_image Aptio Setup - AMI AMD CBS NBIO RAS Common Options NBIO RAS Control [Auto] Egress Poison Severity High 30011 Egress Poison Severity Low 4 NBIO SyncFlood Generation [Auto] NBIO SyncFlood Reporting [Auto] Egress Poison Mask High FFFCFFFF Egress Poison Mask Low FFFFFFFB Uncorrected Converted to Poison 30000 Enable Mask High Uncorrected Converted to Poison 4 Enable Mask Low System Hub Watchdog Timer 2600 PCIe Aer Reporting Mechanism [Auto] Edpc Control [Auto] ACS RAS Request Value [Auto] NBIO Poison Consumption [Auto] Sync Flood on PCIe Fatal Error [Auto] (0) Disabled, (1) MCA ++: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI
ParameterDescription
NBIO RAS Common Options
NBIO RAS Control Options available: Disabled, MCA, Auto. Default setting is Auto.
Egress Poison Severity HighConfigures the Egress Poison High Severity. Each bit set to 1 enables High severity on the associated IOHC egress port. A bit of 0 indicates LOW severity.
Egress Poison Severity LowConfigures the Egress Poison Low Severity. Each bit set to 1 enables High severity on the associated IOHC egress port. A bit of 0 indicates LOW severity.
NBIO SyncFlood GenerationThe value may be used to mask SyncFlood caused by NBIO RAS options. Options available: Enabled, Disabled, Auto. Default setting is Auto.
NBIO SyncFlood ReportingThe value may be used to enable SyncFlood reporting to APML. Options available: Enabled, Disabled, Auto. Default setting is Auto.
Egress Poison Mask HighEnables mask for masking of errors logged in EGRESS_POISON_STATUS. For each bit set to 1, errors are masked. For each bit set to 0, errors trigger response actions.
Egress Poison Mask LowEnables mask for masking of errors logged in EGRESS_POISON_STATUS. For each bit set to 1, errors are masked. For each bit set to 0, errors trigger response actions.
Uncorrected Converted to Poison Enable Mask HighEnables mask for masking of uncorrectable parity errors on internal arrays.
Uncorrected Converted to Poison Enable Mask LowEnables mask for masking of uncorrectable parity errors on internal arrays.
System Hub Watchdog TimerSpecifies the timer interval of the SYSHUB Watchdog timer in milliseconds.
PCIe Aer Reporting MechanismSelects the method of reporting AER errors from PCI Express. Options available: Firmware First, Firmware First but allow OS First, OS First, Auto. Default setting isAuto.
Edpc Control Options available: Disabled, Enabled, Auto. Default setting isAuto.
ACS RAS Request ValueOptions available: Direct Request Access Enabled, Request Blocking Enabled, Request Redirect Enabled, Auto. Default setting isAuto.
NBIO Poison Consumption Options available: Auto, Enabled, Disabled. Default setting isAuto.
Sync Flood on PCIe Fatal ErrorOptions available: Auto, True, False. Default setting isAuto.

5-3-4-3 nBif Common Options
GIGABYTE G493-ZB2 - 5-3-4-2 NBIO RAS Common Options - 2

text_image Aptio Setup - AMI AMD CBS nBIf Common Options ► MPDMA-TF ► RCC_DEVO MPDMA-TF +: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI
ParameterDescription
MPDMA-TFSRIOV- Options available: Auto, Disabled, Enabled. Default setting isAuto.ARI- Options available: Auto/Default, Disabled, Enabled. Default setting isAuto/Default.AER- Options available: Auto, Disabled, Enabled. Default setting isAuto.ACS- Options available: Auto, Disabled, Enabled. Default setting isAuto.ATS- Options available: Auto, Disabled, Enabled. Default setting isAuto.PASID- Options available: Auto, Disabled, Enabled. Default setting isAuto.RTR- Options available: Auto, Disabled, Enabled. Default setting isAuto.PAGE_REQ- Options available: Auto, Disabled, Enabled. Default setting isAuto.PWR- Options available: Auto, Disabled, Enabled. Default setting isAuto.ATC_ENABLE- Options available: Auto, Disabled, Enabled. Default setting isAuto.
MPDMA-TF(continued)SDXI Class CodeOptions available: Auto, Disabled, Enabled. Default setting isAuto.PASID ControlOptions available: Auto, Disabled, Enabled. Default setting isAuto.ATOMICOP_REQUESTOptions available: Auto, Disabled, Enabled. Default setting isAuto.
RCC_DEV0ACS Rcc_Dev0Options available: Auto, Disabled, Enabled. Default setting isAuto.AER Rcc_Dev0Options available: Auto, Disabled, Enabled. Default setting isAuto.DIfEnableStrap1Options available: Auto, Disabled, Enabled. Default setting isAuto.Phy16GTStrap1Options available: Auto, Disabled, Enabled. Default setting isAuto.MarginEnStrap1Options available: Auto, Disabled, Enabled. Default setting isAuto.SourceValStrap5Options available: Auto, Disabled, Enabled. Default setting isAuto.TranslationalBlockingStrap5Options available: Auto, Disabled, Enabled. Default setting isAuto.P2pReq ACS ControlOptions available: Auto, Disabled, Enabled. Default setting isAuto.P2pCompStrap5Options available: Auto, Disabled, Enabled. Default setting isAuto.UpstreamFwdStrap5Options available: Auto, Disabled, Enabled. Default setting isAuto.P2PEgressStrap5Options available: Auto, Disabled, Enabled. Default setting isAuto.DirectTranslatedStrap5Options available: Auto, Disabled, Enabled. Default setting isAuto.SsidEnStrap5Options available: Auto, Disabled, Enabled. Default setting isAuto.PriEnPageReqOptions available: Auto, Disabled, Enabled. Default setting isAuto.PriResetPageReqOptions available: Auto, Disabled, Enabled. Default setting isAuto.SourceVal ACS cntlOptions available: Auto, Disabled, Enabled. Default setting isAuto.TranslationalBlocking ACS ControlOptions available: Auto, Disabled, Enabled. Default setting isAuto.P2pComp ACS ControlOptions available: Auto, Disabled, Enabled. Default setting isAuto.UpstreamFwd ACS ControlOptions available: Auto, Disabled, Enabled. Default setting isAuto.
RCC_DEV0(continued)◆ P2PEgress ACS Control- Options available: Auto, Disabled, Enabled. Default setting isAuto.◆ P2pReqStrap5- Options available: Auto, Disabled, Enabled. Default setting isAuto.◆ E2E_PREFIX- Options available: Auto, Disabled, Enabled. Default setting isAuto.◆ EXTENDED_FMT- Options available: Auto, Disabled, Enabled. Default setting isAuto.◆ AtomicRoutingStrap5- Options available: Auto, Disabled, Enabled. Default setting isAuto.

5-3-4-4 Link EQ Preset Options
GIGABYTE G493-ZB2 - 5-3-4-2 NBIO RAS Common Options - 3

text_image Aptio Setup - AMI AMD CBS Link EQ Preset Options GEN3 GEN4 GEN5 GEN3 +: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI
ParameterDescription
GEN3/4/5Press [Enter] to configure advanced items.◆ Preset Search Mask Configuration- Options available: Custom, Auto. Default setting isAuto.

5-3-5 FCH Common Options

GIGABYTE G493-ZB2 - 5-3-5 FCH Common Options - 1

text_image Aptio Setup - AMI AMD CBS FCH Common Options ► I3C/I2C Configuration Options ► SATA Configuration Options ► USB Configuration Options ► Ac Power Loss Options ► Uart Configuration Options ► ESPI Configuration Options ► FCH RAS Options ► Miscellaneous Options I3C/I2C Configuration Options ++ +: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI

Parameter Description

FCH Common Options

I3C/I2C Configuration Options Press [Enter] for configuration of advanced items.

SATA Configuration Options Press [Enter] for configuration of advanced items.

USB Configuration Options Press [Enter] for configuration of advanced items.

AC Power Loss Options Press [Enter] for configuration of advanced items.

Uart Configuration Options Press [Enter] for configuration of advanced items.

ESPI Configuration Options Press [Enter] for configuration of advanced items.

FCH RAS Options Press [Enter] for configuration of advanced items.

Miscellaneous Options Press [Enter] for configuration of advanced items.

5-3-5-1 I3C/I2C Configuration Options

GIGABYTE G493-ZB2 - 5-3-5-1 I3C/I2C Configuration Options - 1

text_image Aptio Setup - AMI AMD CBS I3C/I2C Configuration Options I3C/I2C 0 Enable [Auto] I3C/I2C 1 Enable [Auto] I3C/I2C 2 Enable [Auto] I3C/I2C 3 Enable [Auto] I2C 4 Enable [Auto] I2C 5 Enable [Auto] Release SPD Host Control [Auto] I2C SDA Hold Override [Auto] APML SB-TSI Mode [I3C] I3C Mode Speed [Auto] I3C SDA Hold Value 2 I3C Push Pull HCNT Value 8 Enable or disable Inter-Integrated Circuit Control 0 +: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI
ParameterDescription
I3C/I2C Configuration Options
I3C/I2C 0/1/2/3 EnableOptions available: Both Disabled, I3C Enabled, I2C Enabled, Auto. Default setting is Auto.
I2C 4/5 EnableOptions available: Disabled, Enabled, Auto. Default setting is Auto.
Release SPD Host ControlOptions available: Disabled, Enabled, Auto. Default setting is Auto.
I2C SDA Hold OverrideOptions available: Disabled, Enabled, Auto. Default setting is Auto.
APML SB-TSI ModeOptions available: I3C, I2C. Default setting is I3C.
I3C Mode SpeedOptions available: SDR2(6MHz), SDR0(12.5MHz), Auto. Default setting is Auto.
I3C SDA Hold ValueConfigures I3C SDA Hold value.
I3C Push Pull HCNT ValueSCL push-pull High count for I3C transfers targeted to I3C devices.

5-3-5-2 SATA Configuration Options

GIGABYTE G493-ZB2 - 5-3-5-2 SATA Configuration Options - 1

text_image Aptio Setup - AMI AMD CBS SATA Configuration Options SATA Enable [Auto] SATA RAS Support [Auto] SATA Staggered Spin-up [Auto] SATA Disabled AHCI Prefetch [Auto] Function Aggressive SATA Device Sleep P0 [Auto] Aggressive SATA Device Sleep P1 [Auto] ▶ SATA Controller options Disable or enable OnChip SATA controller +: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI
ParameterDescription
SATA Configuration Options
SATA EnableEnable/Disable OnChip SATA controller.Options available: Disabled, Enabled, Auto. Default setting isAuto.
SATA RAS SupportOptions available: Disabled, Enabled, Auto. Default setting isAuto.
SATA Staggered Spin-upOptions available: Disabled, Enabled, Auto. Default setting isAuto.
SATA Disabled AHCI Prefetch FunctionOptions available: Disabled, Enabled, Auto. Default setting isAuto.
Aggressive SATA Device Sleep P0/P1Options available: Disabled, Enabled, Auto. Default setting isAuto.
SATA Controller optionsPress [Enter] for configuration of advanced items.SATA Controller EnableSATA Controller eSATSATA Controller DevSlpSATA Controller SGPIO

5-3-5-3 USB Configuration Options

GIGABYTE G493-ZB2 - 5-3-5-3 USB Configuration Options - 1

text_image Aptio Setup - AMI AMD CBS USB Configuration Options XHCI Controller0 enable [Auto] XHCI Controller1 enable [Auto] USB ecc SMI Enable [Auto] ▶ MCM USB enable Enable or disable USB3 controller. +: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI
ParameterDescription
USB Configuration Options
XHCI Controller0/1 enableEnable/Disable USB controller.Options available: Enabled, Disabled, Auto. Default setting isAuto.
USB ecc SMI EnableOptions available: Enable, Off, Auto. Default setting isAuto.
MCM USB enablePress [Enter] for configuration of advanced items.♦ XHCI2/ XHCI3 enable (Socket1)– Options available: Enabled, Disabled, Auto. Default setting isAuto.

5-3-5-4 AC Power Loss Options
GIGABYTE G493-ZB2 - 5-3-5-3 USB Configuration Options - 2

text_image Aptio Setup - AMI AMD CBS Ac Power Loss Options Ac Loss Control [Power Off] Select Ac Loss Control Method +: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI
ParameterDescription
AC Power Loss Options
AC Loss ControlSelects the AC Loss Control Method. Options available: Power Off, Power On, Last State. Default setting is Power Off.

5-3-5-5 Uart Configuration Options

GIGABYTE G493-ZB2 - 5-3-5-5 Uart Configuration Options - 1

text_image Aptio Setup - AMI AMD CBS Uart Configuration Options Uart 0 Enable [Auto] Uart 1 Enable [Auto] Uart 2 Enable [Auto] Uart 3 Enable [Auto] Enable or disable Uart0. Uart 0 has no HW flow control if Uart 2 is enabled +: Select Screen ↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI
ParameterDescription
Uart Configuration Options
Uart 0/1/2/3 EnableOptions available: Disabled, Enabled, Auto. Default setting is Auto.

5-3-5-6 ESPI Configuration Options
GIGABYTE G493-ZB2 - 5-3-5-5 Uart Configuration Options - 2

text_image Aptio Setup - AMI AMD CBS ESPI Configuration Options ESPI Enable [Auto] No help string +: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI
ParameterDescription
ESPI Configuration Options
ESPI EnableOptions available: Disabled, Enabled, Auto. Default setting isAuto.

5-3-5-7 FCH RAS Options

GIGABYTE G493-ZB2 - 5-3-5-7 FCH RAS Options - 1

text_image Aptio Setup - AMI AMD CBS FCH RAS Options ALink RAS Support [Auto] Reset After Sync-Flood [Auto] Enable FCH A-Link parity error +: Select Screen 14: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI
ParameterDescription
FCH RAS Options
ALink RAS SupportEnable/Disable the ALink RAS Support.Options available: Disabled, Enabled, Auto. Default setting isAuto.
Reset After Sync-FloodEnables AB to forward downstream sync-flood message to system controller.Options available: Enabled, Disabled, Auto. Default setting isAuto.

5-3-5-8 Miscellaneous Options

GIGABYTE G493-ZB2 - 5-3-5-8 Miscellaneous Options - 1

text_image Aptio Setup - AMI AMD CBS Miscellaneous Options Boot Timer Enable [Auto] Boot Timer enable. Enable : force PMx44 bit 27 = 1 Disable : force PMx44 bit 27 = 0 Auto:PMx44 bit 27 = PcdBootTimerEnable +: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI
ParameterDescription
Miscellaneous Options
Boot Timer EnableEnable/Disable Boot Timer.Options available: Disabled, Enabled, Auto. Default setting isAuto.

5-3-6 SOC Miscellaneous Control

GIGABYTE G493-ZB2 - 5-3-6 SOC Miscellaneous Control - 1

text_image Aptio Setup - AMI AMD CBS Soc Miscellaneous Control ABL Console Out Control [Auto] ABL Console Out Serial Port [Auto] ABL Console Out Serial Port IO [Auto] ABL Basic Console Out Control [Auto] ABL PMU message Control [Auto] ABL Memory Population message [Warning message] Control PSP error injection support [False] ► Firmware Anti-rollback (FAR) Enable : Enable ConsoleOut Function for ABL Disable : Disable ConsoleOut Function for ABL Auto : Keep default behavior +: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI
ParameterDescription
SOC Miscellaneous Control
ABL Console Out Control ^(Note) Enable/Disable the ConsoleOut function for ABL. Options available: Disable, Enable, Auto. Default setting isAuto.
ABL Console Out Serial Port ^(Note) Options available: eSPI, SOC UART0, SOC UART1, Auto. Default setting isAuto.
ABL Console Out Serial Port IOOptions available: 0x3F8, 0x2F8, 0x3E8, 0x2E8, Auto. Default setting isAuto.
ABL Basic Console Out ControlEnable/Disable the Basic ConsoleOut function for ABL. Options available: Disable, Enable, Auto. Default setting isAuto.
ABL PMU message ControlTo Control the total number of PMU debug messages. Options available: Auto, Detailed debug message, Coarse debug message, Stage completion, Assertion messages, Firmware completion message only. Default setting isAuto.
ABL Memory Population message ControlOptions available: Warning message, Fatal error. Default setting isWarning message.
PSP error injection support Options available: False, True. Default setting isFalse.

(Note) Advanced items are configurable when this item is defined.

Firmware Anti-rollback (FAR)

Press [Enter] for configuration of advanced items.

♦ FAR enforcement state
- Default setting is Enabled.

◆ SPL value in the CPU Fuse

◆ SPL value in the SPL table

FAR Switch

- Options available: Disabled, Enabled, Auto. Default setting is Auto.

5-3-7 Workload Tuning

GIGABYTE G493-ZB2 - 5-3-7 Workload Tuning - 1

text_image Aptio Setup - AMI AMD CBS Workload Tuning **************** Descriptions**************** Use BIOS default workload profile. **************** Workload Profile [Auto] Performance Tracing [Auto] Select the profile for different workloads. +:-: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit version 2.21.1279 Copyright (C) 2023 AMI
ParameterDescription
Workload Tuning
Workload ProfileSelect the profile for different workloads.Options available: CPU Intensive, Java Throughput, Java Latency, Power Efficiency, Memory Throughput Intensive, Storage IO Intensive, NIC Throughput Intensive, NIC Latency Sensitive, Accelerator Throughput, VMware vSphere Optimized, Linux KVM Optimized, Container Optimized, RDBMS Optimized, Big Data Analytics Optimized, IOT Gateway, HPC Optimized, OpenStack NFV, OpenStack for ReakTime Kernel, Auto. Default setting isAuto.
Performance TracingEnable to allow capturing performance traces.Options available: Disabled, Enabled, Auto. Default setting isAuto.

5-3-8 CXL Common Options

GIGABYTE G493-ZB2 - 5-3-8 CXL Common Options - 1

text_image Aptio Setup - AMI AMD CBS CXL Common Options CXL Control [Auto] CXL SFM [Auto] CKL Encryption [Disabled] Temp Gen5 Advertisement [Auto] Sync Header Bypass [Auto] ► CXL RAS Enable/Disable CXL on all ports ++: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI
ParameterDescription
CXL Common Options
CXL Control Options available: Auto, Enabled, Disabled. Default setting is Auto.
CXL SPM Options available: Auto, Enabled, Disabled. Default setting is Auto.
CXL Encryption Options available: Enabled, Disabled. Default setting is Disabled.
Temp Gen5 AdvertisementOptions available: Disabled, Enabled, Auto. Default setting is Auto.
Sync Header Bypass Options available: Auto, Enabled, Disabled. Default setting is Auto.
CXL RASPress [Enter] for configuration of advanced items.CXL Protocol Error Reporting- Options available: Disabled, SameAsPcieAer,ForceAerFwFirstIfCxlPresent. Default setting is SameAsPcieAer.CXL Component Error Reporting- Options available: OS First, FW-First. Default setting is FW-First.

5-4 AMD PBS Menu

AMD PBS Option menu displays submenu options for configuring the function of AMD PBS. Select a submenu item, then press [Enter] to access the related submenu screen.

GIGABYTE G493-ZB2 - 5-4 AMD PBS Menu - 1

text_image Aptio Setup - AMI Main Advanced AMD CBS AMD PBS Option Chipset Server Mgmt Security Boot Save & Exit AMD PBS ► RAS SPI Locking [Disabled] ► CXL Range Encryption AMD CPM RAS related settings +: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI

Parameter Description

RAS Press [Enter] for configuration of advanced items.

SPI LockingEnable/Disable SPI Locking for protect ROM part. Options available: Disabled, Enabled. Default setting is Disabled.
CXL Range EncryptionPress [Enter] for configuration of advanced items.♦ Range1/2/3/4/5/6/7– Configure the Range 1/2/3/4/5/6/7 Memory Base.– Configure the Range 1/2/3/4/5/6/7 Memory Limit/Size.♦ Start CXL Range Encryption

GIGABYTE G493-ZB2 - Parameter Description - 1

text_image Aptio Setup - AMI AMD PBS Option RAS Periodic SMI Control [Enabled] SMI Threshold 5 SMI Scale 1000 SMI Scale Unit [millisecond] SMI Period 1000 GHES Notify Type [Polled] GHES UnCorr Notify Type [NMI] PCIe GHES Notify Type [Polled] PCIe UnCorr GHES Notify Type [NMI] PCIe Root Port Corr Err Mask Reg 0 PCIe Root Port UnCorr Err Mask Reg 0 PCie Root Port UnCorr Error Sev 7EF6030 Reg PCIe Device Corr Err Mask Reg 0 PCIe Device UnCorr Err Mask Reg 100000 PCie Device UnCorr Error Sev Reg 7EF6030 CXL DP CIE Mask Enable [Enabled] DRAM Hard Post Package Repair [Disabled] HEST DMC Structure Support [Disabled] CXL Error Report Support [Disabled] Enable/ disable Periodic SMI for polling [MCA Threshold] error +: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI
ParameterDescription
RAS Periodic SMI ControlEnable/Disable the Periodic SMI for polling [MCA Threshold] error. Options available: Disabled, Enabled. Default setting is Enabled.
SMI Threshold Configures the SMI Threshold value.
SMI Scale Configures the SMI Scale value.
SMI Scale UnitDefines the unit of time scale. Options available: millisecond, second, minute. Default setting is millisecond.
SMI Period Configures the SMI Period.
GHES Notify TypeSelects the Notification type for deferred/ corrected errors. Options available: Polled, SCI. Default setting is Polled.
GHES UnCorr Notify TypeSelects the Notification type for uncorrected errors. Options available: Polled, NMI. Default setting is NMI.
PCIe GHES Notify TypeSelects the Notification type for PCIe corrected errors. Options available: Polled, SCI. Default setting is Polled.
PCIe UnCorr GHES Notify TypeSelects the Notification type for PCIe uncorrected errors. Options available: Polled, NMI. Default setting is NMI.
PCIe Root Port Corr Err Mask RegInitialize the PCIe AER Corrected Error Mask register of Root Port.
PCIe Root Port UnCorr Err Mask RegInitialize the PCIe AER Uncorrected Error Mask register of Root Port.
PCIe Root Port UnCorr Err Sev RegInitialize the PCIe AER Uncorrected Error Severity register of Root Port.
PCIe Device Corr Err Mask RegInitialize the PCIe AER Corrected Error Mask register of PCIe device.
PCIe Device UnCorr Err Mask RegInitialize the PCIe AER Uncorrected Error Mask register of PCIe device.
PCIe Device UnCorr Err Sev RegInitialize the PCIe AER Uncorrected Error Severity register of PCIe device.
CXL DP CIE Mask EnableEnable/Disable masking of CXL DP Correctable Error - Internal Error. Options available: Disabled, Enabled. Default setting is Enabled.
DRAM Hard Post Package RepairThis feature allows spare DRAM rows to replace malfunctioning rows via an in-field repair mechanism. Options available: Disabled, Enabled. Default setting is Disabled.
HEST DMC Structure SupportHEST DMC (Deferred Machine Check) Structure Support. Options available: Disabled, Enabled. Default setting is Disabled.
CXL Error Report SupportEnable/Disable CXL Error Reporting. Options available: Disabled, Enabled. Default setting is Disabled.

5-5 Chipset Setup Menu

Chipset Setup menu displays submenu options for configuring the function of the North Bridge. Select a submenu item, then press to access the related submenu screen.

GIGABYTE G493-ZB2 - 5-5 Chipset Setup Menu - 1

text_image Aptio Setup - AMI Main Advanced AMD CBS AMD PBS Option Chipset Server Mgmt Security Boot Save & Exit PCIe Link Training Type [1 Step] PCIe Compliance Mode [Off] Program All VR [Enabled] ► North Bridge ► Fabric Resource PCIe Link training in 1 or 2 steps. +: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI
ParameterDescription
PCIe Link Training TypeOptions available: 1 Step, 2 Step. Default setting is 1 Step.
PCIe Compliance Mode Options available: Off, On. Default setting is Off.
Program All VREnable/Disable program all VR on MB. Options available: Disabled, Enabled. Default setting is Enabled.
North Bridge Press [Enter] for configuration of advanced items.
Fabric Resource Press [Enter] for configuration of advanced items.

5-5-1 North Bridge

GIGABYTE G493-ZB2 - 5-5-1 North Bridge - 1

text_image Aptio Setup - AMI Chipset North Bridge Configuration Memory Information Total Memory: 786432 MB (DDR5) ▶ CPU 0 Information ▶ CPU 1 Information View Information related to CPU 0 +: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI
ParameterDescription
North Bridge ConfigurationMemory Information
Total Memory Displays the total memory information.
CPU 0/1 Information Press [Enter] to view information related to CPU 0/1.

5-5-2 Fabric Resource

GIGABYTE G493-ZB2 - 5-5-2 Fabric Resource - 1

text_image Aptio Setup - AMI Chipset Fabric Resource CPU0 NBIO0: Base Bus: 0x60 Prefetchable Mmio Above 4G Size: 1500 GB IO Resource: 0x000 PCIe Bus Number 20 Prefetchable Mmio Above 4G size [System Default] PCIe IO Resource FFFF CPU0 NBIO1: Base Bus: 0x40 Prefetchable Mmio Above 4G Size: 1500 GB IO Resource: 0x000 PCIe Bus Number 20 Prefetchable Mmio Above 4G size [System Default] PCIe IO Resource FFFF CPU0 NBIO2: Base Bus: 0x00 Prefetchable Mmio Above 4G Size: 1500 GB IO Resource: 0x000 PCIe Bus Number 20 Prefetchable Mmio Above 4G size [System Default] PCIe IO Resource FFFF Change CPUO NBIO0 PCIe bus number +: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI

GIGABYTE G493-ZB2 - 5-5-2 Fabric Resource - 2

text_image Aptio Setup - AMI Chipset CPU1 NBIO1: Base Bus: 0xC0 Prefetchable Mmio Above 4G Size: 1500 GB IO Resource: 0x000 PCIe Bus Number 20 Prefetchable Mmio Above 4G size [System Default] PCIe IO Resource FFFF CPU1 NBIO2: Base Bus: 0x80 Prefetchable Mmio Above 4G Size: 1500 GB IO Resource: 0x000 PCIe Bus Number 20 Prefetchable Mmio Above 4G size [System Default] PCIe IO Resource FFFF CPU1 NBIO3: Base Bus: 0xA0 Prefetchable Mmio Above 4G Size: 1500 GB IO Resource: 0x000 PCIe Bus Number 20 Prefetchable Mmio Above 4G size [System Default] PCIe IO Resource FFFF Change CPU1 NBIO3 PCIe IO Resource +: Select Screen ↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI
ParameterDescription
Fabric Resource
CPU 0/1 NBIO_# PCIe Bus NumberChange CPU NBIO_# PCIe Bus Number.
Prefetchable Mmio Above 4G sizeChange CPU NBIO_# Prefetchable MMIO Above 4G Size.Options available: System Default, 0, 1G, 2G, 4G, 8G, 16G, 32G, 64G, 128G, 256G, 512G, 1T, 2T, 4T, 8T. Default setting isSystem Default.
PCIe IO Resource Change CPU 0 NBIO_# PCIe IO Resource.

5-6 Server Management Menu

GIGABYTE G493-ZB2 - 5-6 Server Management Menu - 1

text_image Aptio Setup - AMI Main Advanced AMD CBS AMD PBS Option Chipset Server Mgmt Security Boot Save & Exit FRB-2 Timer [Enabled] FRB-2 Timer timeout [6 minutes] FRB-2 Timer Policy [Do Nothing] DS Watchdog Timer [Disabled] DS Wtd Timer Timeout [10 minutes] DS Wtd Timer Policy [Reset] Wait BMC Ready [2 minutes] ► System Event Log ► View FRU information ► BMC network configuration ► IPv6 BMC Network Configuration Enter value Between 3 to 6 min for FRB-2 Timer Expiration value +: Select Screen 14: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI
ParameterDescription
FRB-2 TimerEnable/Disable FRB-2 timer (POST timer).Default setting is Enabled.
FRB-2 Timer timeoutConfigures the FRB2 Timer timeout.Options available: 3 minutes, 4 minutes, 5 minutes, 6 minutes. Default setting is 6 minutes.
FRB-2 Timer PolicyConfigures the FRB2 Timer policy.Options available: Do Nothing, Reset, Power Down, Power Cycle.Default setting is Do Nothing.
OS Watchdog TimerEnable/Disable OS Watchdog Timer function.Options available: Enabled, Disabled. Default setting is Disabled.
OS Wtd Timer Timeout ^(Note) Configures OS Watchdog Timer.Options available: 5 minutes, 10 minutes, 15 minutes, 20 minutes.Default setting is 10 minutes.
OS Wtd Timer Policy ^(Note) Configure OS Watchdog Timer Policy.Options available: Do Nothing, Reset, Power Down, Power Cycle.Default setting is Reset.
Wait BMC ReadyPost wait BMC ready and reboot system.Options available: Disabled, 2 minutes, 4 minutes, 6 minutes. Default setting is 2 minutes.

(Note) This item is configurable when OS Watchdog Timer is set to Enabled.

ParameterDescription
System Event LogPress [Enter] to configure advanced items.
View FRU InformationPress [Enter] to view the FRU information.
BMC network configurationPress [Enter] to configure advanced items.
IPv6 BMC Network ConfigurationPress [Enter] to configure advanced items.

5-6-1 System Event Log

GIGABYTE G493-ZB2 - 5-6-1 System Event Log - 1

text_image Aptio Setup - AMI Server Mgmt Enabling/Disabling Options SEL Components [Enabled] Erasing Settings Erase SEL [NO] When SEL is Full [Do Nothing] Custom EFI Logging Options Log EFI Status Codes [Error code] NOTE: All values changed here do not take effect until computer is restarted. Change this to enable or disable all features of System Event Logging during boot. +: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI
ParameterDescription
Enabling / Disabling Options
SEL ComponentsChange this item to enable or disable all features of System Event Logging during boot.Options available: Disabled, Enabled. Default setting is Enabled.
Erasing Settings
Erase SELChoose options for erasing SEL.Options available: No/Yes, On next reset/Yes, On every reset. Default setting is No.
When SEL is FullChoose options for reactions to a full SEL.Options available: Do Nothing, Erase Immediately. Default setting is Do Nothing.
Custom EFI Logging Options
Log EFI Status CodesEnable/Disable the logging of EFI Status Codes (if not already converted to legacy).Options available: Disabled, Both, Error code, Progress code. Default setting is Error code.

5-6-2 View FRU Information

The FRU page is a simple display page for basic system ID information, as well as System product information. Items on this window are non-configurable.

GIGABYTE G493-ZB2 - 5-6-2 View FRU Information - 1

text_image Aptio Setup - AMI Server Mgmt FRU Information System Manufacturer Giga Computing System Product Name G493-ZB1-RAP1-000 System Version 0100 System Serial Number GMGCD0412A0002 Board Manufacturer Giga Computing Board Product Name MZB3-G41-000 Board Version 123456789AB Board Serial Number S2282800005 Chassis Manufacturer Giga Computing Chassis Product Name 01234567 Chassis Serial Number 01234567890123456789AB ++: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI

5-6-3 BMC Network Configuration

GIGABYTE G493-ZB2 - 5-6-3 BMC Network Configuration - 1

text_image Aptio Setup - AMI Server Mgmt --BMC network configuration-- Lan channel 1 Configuration Address source [DynamicBmcDhcp] Station IP address 10.1.112.112 Subnet mask 255.255.255.0 Router IP address 10.1.112.253 Station MAC address d8-5e-d3-e3-f2-5f VLAN Support [Disabled] Real-time synchronize BMC network parameter values Select to configure LAN channel parameters statically or dynamically(by BIOS or BMC). Unspecified option will not modify any BMC network parameters during BIOS phase +: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI
ParameterDescription
BMC network configuration
Lan Channel 1
Configuration Address sourceSelects to configure LAN channel parameters statically or dynamically (DHCP). Do nothing option will not modify any BMC network parameters during BIOS phase. Options available: Unspecified, Static, DynamicBmcDhcp. Default setting is DynamicBmcDhcp.
Station IP addressDisplays IP Address information.
Subnet maskDisplays Subnet Mask information. Please note that the IP address must be in three digitals, for example, 192.168.000.001.
Router IP addressDisplays the Router IP Address information.
Station MAC addressDisplays the MAC Address information.
VLAN SupportSet BMC to enable/disable VLAN support. Options available: Enabled, Disabled. Default setting is Disabled.
Real-time synchronize BMC network parameter valuesPress [Enter] will set Address source(Static/DHCP) to BMC and then get Station IP address, Subnet mask and Router IP address from BMC.

5-6-4 IPv6 BMC Network Configuration

GIGABYTE G493-ZB2 - 5-6-4 IPv6 BMC Network Configuration - 1

text_image Aptio Setup - AMI Server Mgmt IPv6 EMC Network Configuration IPv6 EMC Lan Channel 1: IPv6 EMC Lan Option [Enable] IPv6 EMC Lan IP Address Source [Dynamic-Obtained by BMC running DHCP] IPv6 EMC Lan IP Address/Prefix ::/0 Length -> [::/0] Enable/Disable IPv6 BMC LAN channel function. Disable option will not modify any EMC network during BIOS Phase ++: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI
ParameterDescription
IPv6 BMC network configuration
IPv6 BMC Lan Channel 1
IPv6 BMC Lan OptionEnable/Disable IPv6 BMC LAN channel function. When this item is disabled, the system will not modify any BMC network during BIOS phase.Options available: Unspecified, Disable, Enable. Default setting is Enable.
IPv6 BMC Lan IP Address SourceSelects to configure LAN channel parameters statically or dynamically (by BIOS or BMC).Options available: Unspecified, Static, Dynamic-Obtained by BMC running DHCP. Default setting is Dynamic-Obtained by BMC running DHCP.
IPv6 BMC Lan IP Address/ Prefix LengthCheck if the IPv6 BMC LAN IP address matches those displayed on the screen.

5-7 Security Menu

The Security menu allows you to safeguard and protect the system from unauthorized use by setting up access passwords.

GIGABYTE G493-ZB2 - 5-7 Security Menu - 1

text_image Aptio Setup - AMI Main Advanced AMD CBS AMD PBS Option Chipset Server Mgmt Security Boot Save & Exit Password Description If ONLY the Administrator's password is set, then this only limits access to Setup and is only asked for when entering Setup. If ONLY the User's password is set, then this is a power on password and must be entered to boot or enter Setup. In Setup the User will have Administrator rights. The password length must be in the following range: Minimum length 3 Maximum length 20 Administrator Password User Password ▶ Secure Boot Set Administrator Password +: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI

There are two types of passwords that you can set:

- Administrator Password

Entering this password will allow the user to access and change all settings in the Setup Utility.

- User Password

Entering this password will restrict a user's access to the Setup menus. To enable or disable this field, a Administrator Password must first be set. A user can only access and modify the System Time, System Date, and Set User Password fields.

ParameterDescription
Administrator PasswordPress [Enter] to configure the administrator password.
User PasswordPress [Enter] to configure the user password.
Secure BootPress [Enter] to configure advanced items.

5-7-1 Secure Boot

The Secure Boot submenu is applicable when your device is installed the Windows® 8 (or above) operating system.

GIGABYTE G493-ZB2 - 5-7-1 Secure Boot - 1

text_image Aptio Setup - AMI Security System Mode Setup Secure Boot [Disabled] Not Active Secure Boot Mode [Custom] ►Restore Factory Keys ►Reset To Setup Mode ►Enter Audit Mode ►Key Management Secure Boot feature is Active if Secure Boot is Enabled, Platform Key(PK) is enrolled and the System is in User mode. The mode change requires platform reset ++: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI
ParameterDescription
System ModeDisplays if the system is in User mode or Setup mode.
Secure BootEnable/ Disable the Secure Boot function.Options available: Enabled, Disabled. Default setting is Disabled.
Secure Boot Mode^(Note) Secure Boot requires all the applications that are running during the booting process to be pre-signed with valid digital certificates. This way, the system knows all files being loaded before Windows loads to the login screen have not been tampered with.When set to Standard, it will automatically load the Secure Boot keys form the BIOS databases.When set to Custom, you can customize the Secure Boot settings and manually load its keys from the BIOS database.Options available: Standard, Custom. Default setting is Standard.
Restore Factory KeysForces the system to user mode and installs factory default Secure Boot key database.
Reset To Setup ModePress [Enter] to reset the system mode to Setup mode.
Enter Audit ModePress [Enter] to set the system mode to audit mode.

(Note) Advanced items prompt when this item is set to Custom.

ParameterDescription
Key ManagementPress [Enter] to configure advanced items.Please note that this item is configurable when Secure Boot Mode is set to Custom.◆ Factory Key Provision- Allows to provision factory default Secure Boot keys when system is in Setup Mode.- Options available: Enabled, Disabled. Default setting is Disabled.◆ Restore Factory Keys- Installs all factory default keys. It will force the system in User Mode.- Options available: Yes, No.◆ Reset To Setup Mode- Reset the system to Setup Mode.- Options available: Yes, No.◆ Enroll Efi Image- Press [Enter] to enroll SHA256 hash of the binary into Authorized Signature Database (db).◆ Export Secure Boot variables- Copy NVRAM content of Secure Boot variables to files in a root folder on a file system device.◆ Secure Boot variable- Displays the current status of the variables used for secure boot.◆ Platform Key (PK)- Displays the current status of the Platform Key (PK).- Press [Enter] to configure a new PK.- Options available: Update.◆ Key Exchange Keys (KEK)- Displays the current status of the Key Exchange Key Database (KEK).- Press [Enter] to configure a new KEK or load additional KEK from storage devices.- Options available: Update, Append.◆ Authorized Signatures (DB)- Displays the current status of the Authorized Signature Database.- Press [Enter] to configure a new DB or load additional DB from storage devices.- Options available: Update, Append.◆ Forbidden Signatures (DBX)- Displays the current status of the Forbidden Signature Database.- Press [Enter] to configure a new dbx or load additional dbx from storage devices.- Options available: Update, Append.
Key Management (continued)◆ Authorized TimeStamps (DBT)– Displays the current status of the Authorized TimeStamps Database.– Press [Enter] to configure a new DBT or load additional DBT from storage devices.– Options available: Update, Append.◆ OsRecovery Signatures– Displays the current status of the OsRecovery Signature Database.– Press [Enter] to configure a new OsRecovery Signature or load additional OsRecovery Signature from storage devices.– Options available: Update, Append.

5-8 Boot Menu

The Boot menu allows you to set the drive priority during system boot-up. BIOS setup will display an error message if the legacy drive(s) specified is not bootable.

GIGABYTE G493-ZB2 - 5-8 Boot Menu - 1

text_image Aptio Setup - AMI Main Advanced AMD CBS AMD PBS Option Chipset Server Hgmt Security Boot Save & Exit Boot Configuration Setup Prompt Timeout 2 Bootup NumLock State [On] Quiet Boot [Enabled] Setup Flash Dump full Setup Data Dump non-default Setup Data Restore Setup Data Boot mode select [UEFI] FIXED BOOT ORDER Priorities Boot Option #1 [Hard Disk] Boot Option #2 [CD/DVD] Boot Option #3 [USB Device] Boot Option #4 [Network:UEFI: PXE IPv4 Intel(R) Network D8:5E:D3:E3:F3:F3] Boot Option #5 [UEFI AP:UEFI: Built-in EFI Shell] ► UEFI NETWORK Drive BBS Priorities ► UEFI Application Boot Priorities Number of seconds to wait for setup activation key. 65535(0xFFFF) means indefinite waiting. +: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1279 Copyright (C) 2023 AMI
ParameterDescription
Boot Configuration
Setup Prompt TimeoutNumber of seconds to wait for setup activation key. 65535 (0xFFFF) means indefinite waiting.Press the numeric keys to input the desired values.
Bootup NumLock StateEnable/Disable the Bootup NumLock function.Options available: On, Off. Default setting is On.
Quiet BootEnable/Disable showing the logo during POST.Options available: Enabled, Disabled. Default setting is Enabled.
Setup FlashPress [Enter] to run setup flash.
Dump full Setup DataPress [Enter] to dump full setup data to file.
Dump non-default Setup DataPress [Enter] to dump non-default setup data to file.
Restore Setup DataPress [Enter] to restore setup data from file (cJson format).
Boot mode selectSelects the boot mode.Options available: LEGACY, UEFI. Default setting is UEFI.
FIXED BOOT ORDER Priorities
Boot Option #1 / #2 / #3 / #4 / #5Press [Enter] to configure the boot priority.By default, the server searches for boot devices in the following sequence:1. Hard drive.2. CD-COM/DVD drive.3. USB device.4. Network.5. UEFI.
UEFI Network Drive BBS PrioritiesPress [Enter] to configure the boot priority.
UEFI Application Boot PrioritiesPress [Enter] to configure the boot priority.

5-9 Save & Exit Menu

The Save & Exit menu displays the various options to quit from the BIOS setup. Highlight any of the exit options then press .

GIGABYTE G493-ZB2 - 5-9 Save &amp; Exit Menu - 1

text_image Aptio Setup - AMI Main Advanced AMD CBS AMD PBS Option Chipset Server Mgmt Security Boot Save & Exit Save Options Save Changes and Exit Discard Changes and Exit Save Changes Default Options Restore Defaults Boot Override UEFI: PXE IPv4 Intel(R) Network D8:5E:D3:E3:F3:F3 UEFI: PXE IPv4 Intel(R) Network D8:5E:D3:E3:F3:F4 UEFI: PXE IPv6 Intel(R) Network D8:5E:D3:E3:F3:F3 UEFI: PXE IPv6 Intel(R) Network D8:5E:D3:E3:F3:F4 UEFI: Built-in EFI Shell Launch EFI Shell from filesystem device Exit system setup after saving the changes. +: Select Screen ↑↓: Select Item Enter: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit version 2.21.1279 Copyright (C) 2023 AMI
ParameterDescription
Save Options
Save Changes and ExitSaves changes made and closes the BIOS setup. Options available: Yes, No.
Discard Changes and ExitDiscards changes made and exits the BIOS setup. Options available: Yes, No.
Save ChangesSaves changes done so far to any of the setup options. Options available: Yes, No.
Default Options
Restore DefaultsLoads the default settings for all BIOS setup parameters. Setup Defaults are quite demanding in terms of resources consumption. If you are using low-speed memory chips or other kinds of low-performance components and you choose to load these settings, the system might not function properly. Options available: Yes, No.
Boot OverridePress [Enter] to configure the device as the boot-up drive.
Launch EFI Shell from filesystem deviceAttempts to Launch EFI Shell application (Shell.efi) from one of the available file system devices.

5-10 BIOS Recovery

The system has an embedded recovery technique. In the event that the BIOS becomes corrupt the boot block can be used to restore the BIOS to a working state. To restore your BIOS, please follow the instructions listed below:

Recovery Instruction:

  1. Copy the XXX.rom to USB diskette.
  2. Setting BIOS Recovery jump to enabled status.
  3. Boot into BIOS recovery.
  4. Run Proceed with flash update.
  5. BIOS updated.

GIGABYTE G493-ZB2 - Recovery Instruction: - 1

text_image Optio Setup - AMI Main Advanced AND COS AND PBS Option Recovery Chipset Server Hmt Security Boot System booted from new Image Partial update is not allowed Only full image can be updated Proceed with flash update Select this to start Flash update ++: Select Screen TI: Select Item Enter: Select +/-: Change Opt. FI: General Help F3: Previous Values FS: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.31.1275 Copyright (C) 2022 AMI

GIGABYTE G493-ZB2 - Recovery Instruction: - 2

text_image Optio Setup - AMI Recovery WARNING! System firmware is being updated. Keyboard is locked. DO NOT TURN THE POWER OFF !!! Once firmware update is completed press any key to reboot the system. Flash update Flesh update completed. Press any key to reset the system Select Screen Select Item Users: Select +/-: Change Opt. F1: General Help F3: Previous Values F9: Optimized Defaults F10: Save & Exit ESC: Exit Version 2.21.1280 Copyright (C) 2021 AMI

5-11 BIOS POST Beep code (AMI standard)

5-11-1 PEI Beep Codes

# of Beeps Description
1Memory not Installed.
1Memory was installed twice (InstallPeiMemory routine in PEI Core called twice)
2Recovery started
3 DXEIPL was not found
3 DXE Core Firmwareware Volume was not found
4 Recovery failed
4S3 Resume failed
7Reset PPI is not available

5-11-2 DXE Beep Codes

# of Beeps Description
1 Invalid password
4 Some of the Architectural Protocols are not available
5 No Console Output Devices are found
5 No Console Input Devices are found
6 Flash update is failed
7 Reset protocol is not available
8 Platform PCI resource requirements cannot be met
Table of contents Click a title to access it
Manual assistant
Powered by Anthropic
Waiting for your message
Product information

Brand : GIGABYTE

Model : G493-ZB2

Category : Server