GE GFE28GELDS - Fridge

GFE28GELDS - Fridge GE - Free user manual and instructions

Find the device manual for free GFE28GELDS GE in PDF.

📄 164 pages English EN 💬 AI Question
Notice GE GFE28GELDS - page 2
View the manual : Français FR English EN Español ES
Manual assistant
Powered by ChatGPT
Waiting for your message
Product information

Brand : GE

Model : GFE28GELDS

Category : Fridge

Download the instructions for your Fridge in PDF format for free! Find your manual GFE28GELDS - GE and take your electronic device back in hand. On this page are published all the documents necessary for the use of your device. GFE28GELDS by GE.

USER MANUAL GFE28GELDS GE

ESPAÑOL Write the model and serial numbers here: Model # _________________ Serial # _________________ Find these numbers on a label on the left side, near the middle of the refrigerator compartment.

GE and GE Profile™ Models Models that start with DFE, GFE, GNE, PFH, PFE, PFD and GFD are Standard Depth Models (SD) Models that start with GYE, PYE, DYE, CYE, PWE, CWE, ZWE and PYD are Counter Depth Models (CD)

INSTALLATION INSTRUCTIONS REFRIGERATORS Bottom Freezer GE is a trademark of the General Electric Company. Manufactured under trademark license.2 49-60764 THANK YOU FOR MAKING GE APPLIANCES A PART OF YOUR HOME. Whether you grew up with GE Appliances, or this is your first, we’re happy to have you in the family. We take pride in the craftsmanship, innovation and design that goes into every GE Appliances product, and we think you will too. Among other things, registration of your appliance ensures that we can deliver important product information and warranty details when you need them. Register your GE appliance now online. Helpful websites and phone numbers are available in the Consumer Support section of this Owner’s Manual. You may also mail in the pre-printed registration card included in the packing material.49-60764 3 STATE OF CALIFORNIA PROPOSITION 65 WARNINGS: WARNING This product contains one or more chemicals known to the State of California to cause cancer and birth defects or other reproductive harm. CAUTION To reduce the risk of injury when using your refrigerator, follow these basic safety precautions.Ŷ 'RQRWFOHDQJODVVVKHOYHVRUFRYHUVZLWKZDUPwater when they are cold. Glass shelves and covers may break if exposed to sudden temperature changes or impact, such as bumping or dropping. Tempered glass is designed to shatter into many small pieces if it breaks.Ŷ .HHSILQJHUVRXWRIWKH³SLQFKSRLQW´DUHDVclearances between the doors and between the doors and cabinet are necessarily small. Be careful closing doors when children are in the area.Ŷ 'RQRWWRXFKWKHFROGVXUIDFHVLQWKHIUHH]HUcompartment when hands are damp or wet, skin may stick to these extremely cold surfaces.Ŷ 'RQRWUHIUHH]HIUR]HQIRRGVZKLFKKDYHWKDZHGcompletely.Ŷ ,QUHIULJHUDWRUVZLWKDXWRPDWLFLFHPDNHUVDYRLGcontact with the moving parts of the ejector mechanism, or with the heating element that UHOHDVHVWKHFXEHV'RQRWSODFHILQJHUVRUKDQGVon the automatic ice making mechanism while the refrigerator is plugged in. SAFETY INFORMATION

READ AND SAVE THESE INSTRUCTIONS

WARNING To reduce the risk of fire, explosion, electric shock, or injury when using your refrigerator follow these basic safety precautions:Ŷ 7KLVUHIULJHUDWRUPXVWEHSURSHUO\LQVWDOOHGDQGORFDWHGLQDFFRUGDQFHZLWKWKH,QVWDOODWLRQ,QVWUXFWLRQVEHIRUHLWLVXVHGŶ 8QSOXJWKHUHIULJHUDWRUEHIRUHPDNLQJUHSDLUVreplacing a light bulb, or cleaning. NOTE: Power to the refrigerator cannot be disconnected by any setting on the control panel. NOTE: Repairs must be performed by a qualified service professional.Ŷ 5HSODFHDOOSDUWVDQGSDQHOVEHIRUHRSHUDWLQJŶ 'RQRWVWRUHRUXVHJDVROLQHRURWKHUIODPPDEOHvapors and liquids in the vicinity of this or any other appliance.Ŷ %HFDXVHRISRWHQWLDOVDIHW\KD]DUGVXQGHUFHUWDLQconditions, we strongly recommend against the use of an extension cord. However, if you must use an extension cord, it is absolutely necessary that it be a 8/OLVWHGLQWKH8QLWHG6WDWHVRUD&6$FHUWLILHGLQ&DQDGDZLUHJURXQGLQJW\SHDSSOLDQFHH[WHQVLRQcord having a grounding type plug and outlet and that the electrical rating of the cord be 15 amperes PLQLPXPDQGYROWVŶ 7RSUHYHQWVXIIRFDWLRQDQGHQWUDSPHQWKD]DUGVWRFKLOGUHQUHPRYHWKHIUHVKIRRGDQGIUHH]HUdoors from any refrigerator before disposing of it or discontinuing its use.Ŷ 'RQRWDOORZFKLOGUHQWRFOLPEVWDQGRUKDQJRQWKHdoor handles or the shelves in the refrigerator. They could seriously injure themselves.

IMPORTANT SAFETY INFORMATION

doors open. These models must be secured with the anti-tip floor bracket to prevent tipping forward, which could result in death or serious injury. Read and follow the entire installation instructions for installing the anti-tip floor bracket packed with your refrigerator.4 49-60764 Do not, under any circumstances, cut or remove the third (ground) prong from the power cord. For personal safety, this appliance must be properly grounded.The power cord of this appliance is equipped with a SURQJJURXQGLQJSOXJZKLFKPDWHVZLWKDVWDQGDUGSURQJJURXQGLQJZDOORXWOHWWRPLQLPL]HWKHSRVVLELOLW\RIHOHFWULFVKRFNKD]DUGIURPWKLVDSSOLDQFHHave the wall outlet and circuit checked by a qualified electrician to make sure the outlet is properly grounded.Where a standard 2-prong wall outlet is encountered, it is your personal responsibility and obligation to have it replaced with a properly grounded 3-prong wall outlet. 'RQRWXVHDQDGDSWHUThe refrigerator should always be plugged into its own individual electrical outlet which has a voltage rating that matches the rating plate.$9ROW$&+]RUDPSIXVHGJURXQGHGelectrical supply is required. This provides the best performance and also prevents overloading house ZLULQJFLUFXLWVZKLFKFRXOGFDXVHDILUHKD]DUGIURPoverheated wires.Never unplug your refrigerator by pulling on the power cord. Always grip plug firmly and pull straight out from the outlet.Repair or replace immediately all power cords that KDYHEHFRPHIUD\HGRURWKHUZLVHGDPDJHG'RQRWuse a cord that shows cracks or abrasion damage along its length or at either end.When moving the refrigerator away from the wall, be careful not to roll over or damage the power cord. CONNECTING ELECTRICITY WARNING ELECTRICAL SHOCK HAZARDPlug into a grounded 3-prong outlet'RQRWUHPRYHWKHJURXQGSURQJ'RQRWXVHDQDGDSWHU)DLOXUHWRIROORZWKHVHLQVWUXFWLRQVFDQUHVXOWLQGHDWKILUHRUHOHFWULFDOVKRFN SAFETY INFORMATION

IMPORTANT SAFETY INFORMATION

READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE WARNING SUFFOCATION AND CHILD ENTRAPMENT HAZARD5HPRYHIUHVKIRRGDQGIUHH]HUGRRUVIURPWKHUHIULJHUDWRUSULRUWRGLVSRVDO)DLOXUHWRGRVRFDQUHVXOWLQFKLOGentrapment which can lead to death or brain damage. IMPORTANT: Child entrapment and suffocation are not problems of the past. Junked or abandoned refrigerators are still dangerous even if they will sit IRU³MXVWDIHZGD\V´,I\RXDUHJHWWLQJULGRI\RXUROGappliance, please follow the instructions below to help prevent accidents.Before You Throw Away Your Old Refrigerator:Ŷ7DNHRIIWKHIUHVKIRRGDQGIUHH]HUGRRUVŶ/HDYHWKHVKHOYHVLQSODFHVRWKDWFKLOGUHQPD\QRWeasily climb inside.RefrigerantsAll refrigeration products contain refrigerants, which under federal law must be removed prior to product GLVSRVDO,I\RXDUHJHWWLQJULGRIDQROGUHIULJHUDWLRQproduct, check with the company handling the disposal about what to do.

PROPER DISPOSAL OF YOUR OLD APPLIANCE

READ AND SAVE THESE INSTRUCTIONS49-60764 5Use this appliance only for its intended purpose as described in this Owner’s Manual. To reduce the risk of severe burns, scald injuries, or death when using your hot water dispenser, the instructions below must be followed:Ŷ'RQRWSHUPLWFKLOGUHQWRXVHWKHKRWZDWHUdispenser.Ŷ The water coming from the dispenser is very hot. 8VHH[WUHPHFDXWLRQZKHQGLVSHQVLQJDQGGULQNLQJwater. Allow water to cool to a drinkable temperature before drinking.Ŷ:KHQGLVSHQVLQJZDWHUEHORZÛ)DOZD\VWHVWWKHtemperature of the water before drinking.Ŷ When dispensing hot water, the container can EHFRPHYHU\KRW8VHDWHPSHUDWXUHLQVXODWLQJFRQWDLQHUVXFKDVFHUDPLFRUIRDP8VLQJFRQWDLQHUmaterials such as paper or plastic may result in DEXUQZKLOHKROGLQJWKHFXS'RQRWXVHJODVVcontainers, as thermal shock can cause the container to break and may result in scalding or lacerations.Ŷ'RQRWXVHZLWKZDWHUWKDWLVPLFURELRORJLFDOO\XQVDIHor of unknown quality.Ŷ Your container should be close to the dispensing SRLQWWRPLQLPL]HWKHVSODVKLQJRIKRWZDWHUŶ A newly installed water filter cartridge will cause water to spurt from the dispenser. Run 2 gallons RIZDWHUWKURXJKWKHFROGZDWHUGLVSHQVHUDERXWPLQXWHVWRUHPRYHDLUIURPWKHV\VWHP8QWLOWKLVDLUis removed from the system through the cold water GLVSHQVHU'2127XVHWKHKRWZDWHUGLVSHQVHUDVit may result in spurting of hot water and lead to hot water scalding.Ŷ The first time the hot water feature is used, confirm LI\RXOLYHDERYHIHHWKLJKDOWLWXGH7KLVOLPLWVthe temperature of the hot water system to avoid boiling. To access the high altitude selection, press Fridge and Door Alarm and control will cycle from Hi AL to Lo ALKLJKDOWLWXGHWRORZDOWLWXGH Ŷ The hot water dispenser is designed to only dispense ZDWHU'RQRWDWWHPSWWRKHDWRUGLVSHQVHDQ\WKLQJRWKHUWKDQZDWHU'RQRWDWWHPSWWRGLVDVVHPEOHRUclean the tank.Ŷ7KHKRWZDWHUGLVSHQVLQJWDQNLVDQRQSUHVVXUL]HGtank, with a vent on the tank and a dispenser tube RXWOHW'RQRWPRGLI\WKHV\VWHPFORVHRUEORFNWKHdispense tube, or connect any other type of device WRWKHWDQNRUGLVSHQVHWXEH'RLQJVRPD\OHDGWRrupture of the tank and hot water scalding. WARNING Scalding Hazard. 7KHKRWZDWHUGLVSHQVHULVFDSDEOHRIKHDWLQJZDWHUWRDWHPSHUDWXUHRIDSSUR[LPDWHO\)&:DWHUWHPSHUDWXUHVDERYH)&FDQFDXVHVHYHUHEXUQVRUGHDWKIURPVFDOGLQJ&KLOGUHQWKHGLVDEOHGDQGthe elderly are at highest risk of being scalded.

Space-saving ice maker* ,FHPDNHUDQGELQDUHORFDWHGRQWKHGRRUFUHDWLQJ more usable storage space. Showcase LED lighting /('OLJKWLQJLVSRVLWLRQHGWKURXJKRXWWKHLQWHULRUWR VSRWOLJKWDUHDVLQWKHUHIULJHUDWRU/('VDUHORFDWHG XQGHUWKHIUHVKIRRGGRRUWROLJKWWKHIUHH]HUZKHQ opened. Drop-down tray* Allows for extra door storage when you need it and tucks away when you don’t. Full-width temperature controlled drawer Adjustable temperature control bin that can accommodate larger items. Dairy bin Separate compartment for your items. Ice bin/Ice maker* ,FHPDNHUZLWKLFHVWRUDJHELQV QuickSpace™ shelf* )XQFWLRQVDVDQRUPDOIXOOVL]HGVKHOIZKHQQHHGHG and easily slides back to store tall items below. Spillproof shelves 'HVLJQHGWRFDSWXUH\RXUVSLOOVIRUHDVLHUFOHDQXS Anti-slip Mat /LQHUWKDWFDSWXUHVVSLOOVNHHSVFRQWDLQHUVIURP shifting when the door is opened and is easily removable for cleaning. Removable door bin Can be removed for those with a wall limiting the door opening. Climate zone bin Separate bins for produce storage. Water filter )LOWHUVZDWHUDQGLFH

  • Select models only. Features

when opened. Full-width temperature controlled drawer Adjustable temperature control bin that can accommodate larger items. Freezer Ice maker/Ice Bin* An ice maker in both compartments give you more ice whenever you need

to store tall items below. Spillproof shelves 'HVLJQHGWRFDSWXUH\RXUVSLOOVIRUHDVLHUFOHDQXS Removable door bin Can be removed for those with a wall limiting the door opening. Climate zone bin Separate bins for produce storage. Water filter )LOWHUVZDWHUDQGLFH Rotating Bin* Can be rotated out for easy access. Door in Door Latch* 6TXHH]HWKHODWFKRQWKHXQGHUVLGHRIWKHKDQGOHWRRSHQWKHRXWHUGRRU

  • Select models only. Features

1. Open left fresh food door.

2. Pull down latch to release bin

door. 8VLQJKDQGKROGOLIWLFHEXFNHW up and out to clear locators in bottom of bin.

4. To replace the ice bucket, set

it on the guide brackets and push until the ice bucket seats properly. ,IEXFNHWFDQQRWEHUHSODFHG

URWDWHWKH,FH%XFNHW)RUNWXUQ

clockwise. Ice/water filter Remove filter/bypass plug Push the indent on the cover and pull open filter door fully. Rotate the ILOWHUE\SDVVSOXJDVIDUDVLWZLOOJR DQGSXOOWKHILOWHUE\SDVVSOXJWRZDUG you to remove. Installing the filter cartridge 3XVKWKHQHZILOWHUE\SDVVSOXJ straight in aligning the lugs with the notches in cabinet and rotate the ILOWHUE\SDVVSOXJLQWRWKHUHFHVVLQ the cabinet. Make sure the front of the filter is toward the interior of the refrigerator. Close the cover making sure the indent snaps into position. ,FHEXFNHW/DWFK*Select Models OnlyPush in and pull openSwing Push \ Pull12 WARNING Scalding Hazard.* 8VHRIWKHKRWZDWHUGLVSHQVHUSULRUWRSXUJLQJ air from the system may result in spurting of hot ZDWHUDQGOHDGWRKRWZDWHUVFDOGLQJ)ROORZWKH

LQVWUXFWLRQVIRU³:DWHU)LOWHU6WHS´RQSDJH

16 to purge all air from the system through the cold water dispenser prior to using the hot water dispenser. The first time the hot water feature is used, confirm if you live above 5000 feet (high altitude). This limits the temperature of the hot water system to avoid boiling. To access the high altitude selection, see Controls. Features

Control Style D: The temperature controls can display both the SET temperature as well as the actual temperature LQWKHUHIULJHUDWRUDQGIUHH]HU7KHDFWXDOWHPSHUDWXUHPD\YDU\VOLJKWO\IURPWKH6(7WHPSHUDWXUHEDVHGRQXVDJH

DQGRSHUDWLQJHQYLURQPHQW3:(DQG*1(RQO\

NOTE: The refrigerator is shipped with protective film covering the temperature controls. ,IWKLVILOPZDVQRWUHPRYHGGXULQJLQVWDOODWLRQUHPRYHLWQRZ PFE28P, PYE22P Control Style A, Single Serve Models PFH28, PFE28K, DFE28, PFD28, PYE22K, PYD22, DYE22

of the fresh food air tower and thus blocking the air flow. Changing the Temperature for Control Style A To Change the Refrigerator Temperature: Press the Fridge button and current set temperature will display. Pressing and releasing the button will cycle through the available temperature settings. Press and hold button for Turbo Cool feature. The display will show tC. To Change the Freezer Temperature: Press the Freezer button and current set temperature will display. Pressing and releasing the button will cycle through the available temperature settings. Press and hold button for Turbo Freeze feature. The display will show tF. Cooling system can be turned off by pressing and holding Freezer and Start Heating. OFF will be displayed. To turn on, press Fridge or Freezer. ON will be displayed. Turning the cooling system off stops the cooling to the refrigerator, but it does not shut off the electrical power. Changing the Temperature for Control Styles B and C To change the temperature, press and release the Freezer or Fridge pad. The display will show the set temperature. To change the temperature, press either the Freezer or Fridge pad until the desired temperature is displayed. Press and hold button for Turbo Cool feature. The display will show tC. Press and hold button for Turbo Freeze feature. The display will show tF. To turn off the cooling system press and hold the Fridge and Ice Maker buttons. To turn on, press Fridge or Freezer. Turning the cooling system off stops the cooling to the refrigerator, but it does not shut off the electrical power. Changing Temp. for Control Style D 7HPSHUDWXUH'LVSOD\LVORFDWHGRQLQVLGHRIOHIWKDQG refrigerator door. To change the temperature, press and release the REFRIGERATOR or FREEZER pad. The ACTUAL TEMP light will come on and the display will show the actual temperature. To change the temperature, tap either the REFRIGERATOR or FREEZER pad until the desired temperature is displayed. To turn OFF cooling system, press and hold the REFRIGERATOR and FREEZER pads simultaneously for 3 seconds. When cooling system is OFF the display should read OF. To turn ON cooling system, press either REFRIGERATOR or FREEZER pad. The display will show the preset temperature settings of 37°F for refrigerator and 0°FIRUIUHH]HU Turning the cooling system off stops the cooling to refrigerator, but it does not shut off the electrical power. Controls USING THE REFRIGERATOR: Controls49-60764 11 USING THE REFRIGERATOR: Controls Controls Ice Hands-free Autofill* Hands-free Autofill uses sensors to monitor container height to automatically dispense filtered water without having to activate the paddle. Start Heating* The Start Heating button is used to initiate the water heating for the Single Serve feature. To abort the Start Heating feature, press and hold the Start Heat button for 3 seconds. Freezer temp control $GMXVWIUHH]HUFRPSDUWPHQWWHPSHUDWXUH Fresh food temp control Adjust fresh food compartment temperature. TurboFreeze™ setting Activate TurboFreezeWRTXLFNO\UHVWRUHIUHH]HU temperatures after frequent door openings. TurboCool™ setting Activate TurboCool to quickly restore fresh food temperature after frequent door openings. Lock Controls Control Style A - Press and hold the Door Alarm pad for 3 seconds to lock out ice and water dispenser and all feature and temperature buttons. Control Styles B & C - Press Lock pad and hold 3 seconds to lock out ice and water dispenser and all feature and temperature buttons. Dispenser light /LJKWLQJWKDWFDQEHWXUQHGRQRIIWROLJKW\RXUGLVSHQVHU Door Alarm 6RXQGVWRDOHUWZKHQWKHIUHH]HURUIUHVKIRRGGRRUVKDYH been left open. Press and hold Door Alarm pad and it will toggle the sound between low, high, and off. Brew Size*

7KH%UHZ6L]HEXWWRQLVXVHGWRVHOHFWWKHGHVLUHGFXS

VL]HIRUVLQJOHVHUYH3UHVVDQGKROGWKHEXWWRQIRU

seconds to toggle the brew type between Coffee and Cocoa. Ice maker setting 7XUQ\RXULFHPDNHUVRQRII Cooling system On/Off Control Style A - Press and hold Freezer and Start Heating simultaneously to turn cooling system off. To turn cooling system on press either the Fridge or Freezer. Control Style B & C - Press and hold Fridge and Ice Maker simultaneously for 3 seconds to turn the cooling system off. To turn cooling system on press either the Fridge or Freezer. Brew Dispense Press and hold Brew Dispense button for 3 seconds, but no longer than 6 seconds, to dispense coffee or cocoa. F°/C° Control Style A - Press and hold Freezer and Brew Size WRVZLWFKEHWZHHQ)& Control Style B & C - Press and hold Ice Maker and Door Alarm simultaneously for 3 seconds to switch EHWZHHQ)& Sound Control for pad chimes Control Style A - Press and hold the Light pad: Once for

+LJKWR2IIWZLFHIRU2IIWR/RZDQGWKUHHWLPHVIRU/RZ

to High. Control Styles B & C - Press and hold the Door Alarm

High Altitude Control Style A (PYE and PFE only) - Press and hold Fridge and Door Alarm for to toggle between Hi Al and /R$/IRUKLJKDOWLWXGHDQGORZDOWLWXGH Additional settings:

  • &RQQHFWHG+RPHUHDG\3)(33<(33)+RQO\
  • :DWHU)LOWHU - An indicator will illuminate when the filter needs to be replaced. When a new filter is installed the indicator will go off. Additional Mode:

Control Style B & C - Press and hold Lock and Light

Controls Style D, Internal Controls GNE29, PWE23 Door Alarm 6RXQGVWRDOHUWZKHQWKHIUHH]HURUIUHVKIRRGGRRUV have been left open. Reset Filter Hold for 3 seconds after replacing filter. Lock Controls Press and hold 3 seconds to lock out ice and water dispenser and all feature and temperature buttons. Freezer temp control $GMXVWIUHH]HUFRPSDUWPHQWWHPSHUDWXUH Refrigerator temp control Adjust fresh food compartment temperature Ice maker setting 7XUQ\RXULFHPDNHURQRII Controls USING THE REFRIGERATOR: Controls49-60764 13

USING THE REFRIGERATOR: 'LVSHQVHU

'LVSHQVHU7UD\ Important Facts About Your Dispenser Ŷ'RQRWDGGLFHIURPWUD\VRUEDJVWRWKHGRRULFHPDNHUEXFNHW,WPD\QRWFUXVKRUGLVSHQVHŶ Avoid overfilling glass with ice and use of narrow glasses. Backed-up ice can jam the chute or cause the GRRULQWKHFKXWHWRIUHH]HVKXW,ILFHLVEORFNLQJWKHchute remove the ice bucket, poke it through with a wooden spoon.Ŷ Beverages and foods should not be quick-chilled in the door ice maker bin. Cans, bottles or food packages in the storage drawer may cause the ice maker or auger to jam.Ŷ To keep dispensed ice from missing the glass, put the glass close to, but not touching, the dispenser opening.Ŷ Some crushed ice may be dispensed even though you selected CUBED ICE. This happens occasionally when a few cubes accidentally get directed to the crusher.Ŷ After crushed ice is dispensed, some water may drip from the chute.Ŷ Sometimes a small mound of snow will form on the door in the ice chute. This condition is normal and usually occurs when you have dispensed crushed ice repeatedly. The snow will eventually evaporate.,IQRZDWHULVGLVSHQVHGZKHQWKHUHIULJHUDWRULVILUVWinstalled, there may be air in the water line system. Press the dispenser paddle for at least five minutes to remove trapped air from the water line and to fill the water system. To flush out impurities in the water line, throw away the first six full glasses of water.To remove Dispenser Tray (Type A and B Only)Ŷ3XOO'LVSHQVHU7UD\RXWXQWLOLWVWRSVŶ/RFDWHWDELQWKHFHQWHURQWKHERWWRPDQGSXVKXSŶ3XOO'LVSHQVHU7UD\DVVHPEO\RXWŶ/LIW'LVSHQVHU7UD\RXWDWFHQWHUQRWFKWRFOHDQTo remove Dispenser Tray (Type C Only)*UDVS'LVSHQVHU7UD\DQGSXOOILUPO\XQWLOLWFRPHVRXWTo reinstall Dispenser Tray (Type A and B Only)Ŷ3ODFHWKH'LVSHQVHU7UD\FRYHURQWRSRIFDWFKWUD\and position under the two plastic retainers on either side.Ŷ&HQWHU'LVSHQVHUWUD\DQGDOLJQZLWKFHQWHUJXLGHVŶ Push in until it locks firmly in place.To reinstall Dispenser Tray (Type C Only)/LQHXSWKHJXLGHRQWUD\ERWWRPZLWKWUDFNRQGLVSHQVHUand slide it in until it stops against the back of the dispenser.Water & Ice Dispenser6HH$ERXWWKHFRQWUROVwith temperature settings & About the control IHDWXUHV To Use the Internal Water Dispenser* The water dispenser is located on the left wall inside the refrigerator compart-ment.To dispense water: Hold the glass against the recess. Push the water dispenser button.Hold the glass underneath the dispenser for 2–3 seconds after releasing the dispenser button. Water may continue to dispense after the button is released.,IQRZDWHULVGLVSHQVHGZKHQWKHUHIULJHUDWRULVILUVWinstalled, there may be air in the water line system. Press the dispenser button for at least 5 minutes to remove trapped air from the water line and to fill the water sys-WHP'XULQJWKLVSURFHVVWKHGLVSHQVHUQRLVHPD\EHloud as the air is purged from the water line system. To flush out impurities in the water line, throw away the first 6 glassfuls of water.NOTE: To avoid water deposits, the dispenser should be cleaned periodically by wiping with a clean cloth or sponge. WARNING Laceration HazardŶ Never put fingers or any other object into ice crusher GLVFKDUJHRSHQLQJ'RLQJVRFDQUHVXOWLQFRQWDFWLQJthe ice crushing blades and lead to serious injury or amputationŶ8VHDVWXUG\JODVVZKHQGLVSHQVLQJLFH$GHOLFDWHglass may break and result in personal injury.*Select Models Only Dispenser*14 49-60764 To Use HANDS FREE AUTOFILL:

experienced, use less ice. Sensors *Select Models Only Single Serve Keurig K-Cup Brewer* WARNING Scalding Hazard. Ŷ The water coming from the dispenser is very hot and can cause scalds or burns. Read all warnings on page 5 prior to use. Ŷ'RQRWSHUPLWFKLOGUHQWRXVHWKHEUHZHU Ŷ Always use a container that is suitable for hot liquids FHUDPLFIRDPHWF Ŷ'RQRWEUHZLQWRDPXJPDGHRIJODVV'RLQJVRPD\ cause the glass to crack or break. Ŷ,I\RXOLYHDERYHIHHWSUHVVFridge and Door AlarmDQGFRQWUROZLOOF\FOHIURP/RZ$OWLWXGH/R$/

Ŷ DO NOT use the hot water dispenser immediately after installing a new water filter as it may result in spurting RIKRWZDWHU'LVSHQVHFROGZDWHUIRUDERXWPLQXWHV to purge air from the system prior to dispensing hot water. Important Facts about HOT WATER AUTOFILL* USING THE REFRIGERATOR:$872),//.HXULJ.&XS%UHZHU49-60764 15

  • There are two sharp needles located inside the .&XSEUHZHU7RDYRLGULVNRILQMXU\GRQRWSXW\RXUILQJHUVLQVLGHWKHEUHZHU8VHFDXWLRQwhen cleaning.
  • .HHSWKH.&XSEUHZHURXWRIWKHUHDFKRI children, as they may be injured in using the .&XSEUHZHULQFRUUHFWO\

Dispense 2QFHWKHKHDWLQJSURFHVVLVFRPSOHWHWKH'LVSHQVHOLJKWRQWKHGLVSOD\ZLOOIODVKTo dispense, slide the brewer into the rails. Make sure the brewer is pushed all the way into the bracket. Place your mug on the drip tray mug icon, under the red brew spout. Press and hold Brew Dispense for 3 seconds until you hear the dispenser engage. Cleaning the brewer

7KH.&XSEUHZHULVWRSUDFNGLVKZDVKHUVDIH ,WLVUHFRPPHQGHGWRULQVHLWWKRURXJKO\DIWHUZDVKLQJWRUHPRYHDOOVRDSUHVLGXH Periodic cleaning of dispenser recess area is recommended as staining may occur with usage RIWKH.&XSEUHZHU.&XSClose the brewer. /LGZLOOclick when secure. Change Brew Size Press the Brew Size button any time during the heating cycle to FKRRVHRUR]7KHGHIDXOWVL]HLVR](QVXUHWKHPXJEHLQJXVHGLVODUJHHQRXJKIRUWKHVL]HVHOHFWHGNOTE: Press and hold the Brew Size button for 3 seconds to toggle between Coffee and Cocoa. The default is Coffee. NOTE: To abort the heating cycle, press and hold the Start Heating button for 3 seconds. To abort the brew dispense cycle, press and hold the Start Heating button for 3 seconds, press the paddle, press any button on the display besides Brew Size or Brew Dispense, or open the right fresh food door.Red brew spout for mug alignmentMug icon for placementRails for the brewer)RU86DQG867HUULWRULHV2QO\ How to use the single serve dispenser Single Serve Keurig K-Cup Brewer* (Cont.)16 49-60764 GE WiFi Connect** GE WiFi Connect Enabled* (PFE28P, PFD28, PYD22, PYE22P, PFH models only)

IRUDQH[WHUQDO:L)L&RQQHFW3OXV0RGXOHVROGVHSDUDWHO\3OHDVHYLVLWwww.GEAppliances. com/connect to learn more about connected appliance features, and to learn what connected appliance apps will work with your Smart Phone.** 7RXVH\RXU:L)LSUHVVWater and Light on the control panel. REGULATORY INFORMATION FCC/IC Compliance Statement:

7KLVGHYLFHFRPSOLHVZLWK3DUWRIWKH)&&5XOHV2SHUDWLRQLVVXEMHFWWRWKHIROORZLQJWZRFRQGLWLRQV

1. This device may not cause harmful interference.

2. This device must accept any interference received, including interference that may cause undesired operation.

This equipment has been tested and found to comply with the limits for a Class B digital device, pursuant to Part

RIWKH)&&5XOHV7KHVHOLPLWVDUHGHVLJQHGWRSURYLGHUHDVRQDEOHSURWHFWLRQDJDLQVWKDUPIXOLQWHUIHUHQFHLQD

residential installation. This equipment generates uses and can radiate radio frequency energy and, if not installed and used in accordance with the instructions, may cause harmful interference to radio communications. However, WKHUHLVQRJXDUDQWHHWKDWLQWHUIHUHQFHZLOOQRWRFFXULQDSDUWLFXODULQVWDOODWLRQ,IWKLVHTXLSPHQWGRHVFDXVHKDUPIXO interference to radio or television reception, which can be determined by turning the equipment off and on, the user is encouraged to try to correct the interference by one or more of the following measures:

  • Reorient or relocate the receiving antenna. ,QFUHDVHWKHVHSDUDWLRQEHWZHHQWKHHTXLSPHQWDQGUHFHLYHU
  • Connect the equipment into an outlet on a circuit different from that to which the receiver is connected. &RQVXOWWKHGHDOHURUDQH[SHULHQFHGUDGLRWHOHYLVLRQWHFKQLFLDQIRUKHOS Labelling: Changes or modifications to this unit not expressly approved by the manufacturer could void the user’s authority to operate the equipment. ConnectPlus module only (or similar communication module) RF Exposure -7KLVGHYLFHLVRQO\DXWKRUL]HGIRUXVHLQDPRELOHDSSOLFDWLRQ$WOHDVWFPRIVHSDUDWLRQGLVWDQFH between the ConnectPlus device and the user’s body must be maintained at all times. GE WiFi Connect Optional * You refrigerator is GE WiFi Connect compatible using the GE ConnectPlus module that is provided with your refrigerator. To connect this appliance to the internet you will need to attach the module to your appliance through the communication port in the appliance. The GE ConnectPlus will allow your appliance to communicate with your smart phone for remote appliance monitoring, control and notifications. Please visit www.GEAppliances.com/ connect to learn more about connected appliance features, to learn what connected appliance App’s will work with your Smart Phone and to learn where you can purchase a GE ConnectPlus.** :L)L&RQQHFWLYLW\)RUDVVLVWDQFHZLWKWKHDSSOLDQFHRUWKHConnectPlusQHWZRUNFRQQHFWLYLW\IRUPRGHOVWKDWDUH :L)LHQDEOHGRU:L)LRSWLRQDOSOHDVHFDOO1-800-220-6899.

)RU86DQG867HUULWRULHV2QO\

Appliance Communication (for customers in the United States and its territories) *Select Models Only USING THE REFRIGERATOR: Appliance Communication49-60764 17

USING THE REFRIGERATOR::DWHU)LOWHU&DUWULGJH53:)(

*Select Models Only Water Filter Cartridge The water filter cartridge is located in the fresh food interior on the left side wall, near the top.

When to replace the filter cartridge The filter cartridge should be replaced every six months RUHDUOLHULIJDOORQVRIZDWHUKDVEHHQGLVSHQVHG or the flow of water to the dispenser or icemaker decreases. Touch Screen Models: A filter status message will appear on the screen when the water filter needs to be replaced. The filter status will automatically update when the filter is replaced. Non-touch Screen Models: A filter indicator light will illuminate on the screen when the water filter needs to be replaced. Removing the filter cartridge To replace the filter, first remove the old cartridge by opening the filter door and pulling on the bottom of the cartridge to allow it to swing outward. When the cartridge can no longer swing, gently pull to unseat it from the

FDUWULGJHKROGHU'21277:,67&$575,'*($VPDOO

amount of water may drip out. Installing the Filter Cartridge

1. Align top of filter cartridge with cartridge holder with

WKHZRUG³FRONT” facing outward then push the cartridge toward the rear of the unit until it is fully VHDWHG'21277:,677+(),/7(5&$575,'*(

2. While continuing to ensure cartridge is fully seated in

the holder, gently swing the filter inward until it is in

SRVLWLRQ,IILOWHUZLOOQRWVZLQJHDVLO\FKHFNWRHQVXUH

filter is properly aligned and fully seated within the cartridge holder. Close the filter door.

3. Run two gallons of water through the cold water

GLVSHQVHUDERXWPLQXWHVWRUHPRYHDLUIURPWKH system. A newly installed filter cartridge will cause water to spurt from the dispenser.8VHDODUJH SLWFKHURUVSRUWVERWWOHWRFDWFKWKHZDWHUVSUD\'2 127XVHKDQGVIUHHDXWRILOOVRPHPRGHOVXQWLODOO air is removed from the system.

5HVHW)LOWHU6WDWXVPHVVDJHQRQWRXFKVFUHHQ

PRGHOV WARNING SCALDING HAZARD.* 8VHRIWKHKRWZDWHUGLVSHQVHUSULRUWRSXUJLQJDLUIURP the system may result in spurting of hot water and lead WRKRWZDWHUVFDOGLQJ)ROORZWKHLQVWUXFWLRQVDERYHWR purge all air from the system through the cold water dispenser prior to using the hot water dispenser. 1RWH,WLVQRUPDOIRUZDWHUWRDSSHDUGLVFRORUHGGXULQJ the initial system flush. Water color will return to normal after first few minutes of dispensing. Filter Bypass Plug To reduce the risk of property damage due to water leakage, you MUST use the filter bypass plug when a replacement filter cartridge is not available. Some models do not come equipped with the filter bypass plug.

7RREWDLQDIUHHE\SDVVSOXJFDOO*(&$5(6,Q

&DQDGDFDOO7KHGLVSHQVHUDQGLFHPDNHU will not operate without either the filter or bypass plug installed. The bypass plug is installed in the same way as a filter cartridge. FCCID: ZKJ-EBX1532P001 ICID: 10229A-EBX1532P001 “This device complies with part 15 of the FCC Rules. Operation is subject to the following two conditions: (1) This device may not cause harmful interference, and (2) this device must accept any interference received, including interference that may cause undesired operation.” “This device complies with Industry Canada licence- exempt RSS standard(s). Operation is subject to the following two conditions: (1) this device may not cause interference, and (2) this device must accept any interference, including interference that may cause undesired operation of the device.” WARNING To reduce the risk associated with choking, do not allow children under 3 years of age to have access to small parts during the installation of this product. The disposable filter cartridge should be replaced every 6 months at the rated capacity, or sooner if a noticeable reduction in flow rate occurs.

are important for products that are filtering your water. GE Appliances has not qualified non-GE Appliances-branded filters for use in GE Appliances and Hotpoint refrigerators and there is no assurance that non-GE Appliances- branded filters meet GE Appliances standards for quality, performance and reliability. If you have questions, or to order additional filter cartridges, visit our website at www.gewaterfilters.com or call GE Appliances Parts and Accessories, 877.959.8688. Customers in Canada should consult the yellow pages for the nearest Camco Service Center. Swing Push \ Pull Water Filter Cartridge - RPWFE18 49-60764 *Select Models Only Fresh Food Storage Options Rearranging the Shelves Shelves in the refrigerator compartment are adjustable. To remove: Remove all items from the shelf. Tilt the shelf up at the front. /LIWWKHVKHOIXSDWWKHEDFNDQGEULQJWKHVKHOIRXW To replace: While tilting the shelf up, insert the top hook at the back of the shelf in a slot on the track. /RZHUWKHIURQWRIWKHVKHOIXQWLOWKHERWWRPRIWKH shelf locks into place. Spillproof Shelves Spillproof shelves have special edges to help prevent spills from dripping to lower shelves. Quick Space Shelf * This shelf splits in half and slides under itself for storage of tall items on the shelf below. 7KLVVKHOIFDQEHUHPRYHGDQGUHSODFHGRUUHORFDWHGMXVW OLNHVSLOOSURRIVKHOYHV NOTE: The back half of the Quick Space Shelf is not adjustable. USING THE REFRIGERATOR:)UHVK)RRG6WRUDJH2SWLRQV49-60764 19 USING THE REFRIGERATOR:)UHVK)RRG6WRUDJH2SWLRQV *Select Models Only Fresh Food Storage Options Left Door Bins

DISPENSER MODELS - FIXED BIN*

To remove: /LIWWKHELQVWUDLJKWXSWKHQSXOORXW The ice maker door bins are not interchangeable, note the location upon removal and replace the bin in its proper location.

NON-DISPENSER MODELS - ADJUSTABLE BINS*

Adjustable bins can easily moved up or down the inside of the door to give better flexibility for storage. To remove: /LIWELQVWUDLJKWXSWKHQSXOORXW Right Door Bins FIXED BINS can easily be carried from refrigerator to work area. To remove: /LIWELQVWUDLJKWXSWKHQSXOORXW ROTATING BIN: To remove: Rotate bin outward then lift straight up. To remove Place hand under metal base and lift up. To remove Metal Base: Place hand under metal base and lift up.

*Select Models Only Climate Zone & Temperature Controlled Drawer 32° 34° 38° Note: Temperatures indicate the appropriate tem- peratures for the food and actual temperatures may vary based on normal operation and other factors such as door openings and fresh food set point. CAUTION Laceration Hazard. 'RQRWVWRUHJODVVERWWOHVDWWKLVVHWWLQJ,I

WKH\DUHIUR]HQWKH\FDQEUHDNDQGUHVXOWLQ

personal injury. Meat Beverage Deli Select ClimateZone .HHSIUXLWVDQGYHJHWDEOHVRUJDQL]HGLQVHSDUDWH compartments for easy access. Excess water that may accumulate in the bottom of the drawers or under the drawers should be wiped dry. Temperature Controlled Drawer*

7KH7HPSHUDWXUH&RQWUROOHG'UDZHULVDIXOOZLGWK

drawer with adjustable temperature control. This drawer can be used for large miscellaneous items. To change setting, press select button. USING THE REFRIGERATOR: &OLPDWH=RQH7HPSHUDWXUH&RQWUROOHG'UDZHU49-60764 21 USING THE REFRIGERATOR: &OLPDWH=RQH7HPSHUDWXUH&RQWUROOHG'UDZHU 'LYLGHU *Select Models Only Climate Zone & Temperature Controlled Drawer How to Remove and Replace Drawer To remove: Pull the drawer out to the stop position. /LIWWKHIURQWRIWKHGUDZHUXSDQGRXW To replace: Pull left and right slides until fully extended. Place drawer back in first and rotate drawer front down to seat on slide. Push the drawer in to closed position. How to Remove and Replace Drawer Divider* To remove: Pull the drawer out to the stop position. Raise the front side of the divider to unhook it from the rear wall of the drawer. To replace: Hook the back of the divider over the rear wall of the drawer. Push the divider down.22 49-60764 Freezer Basket and Drawer Basket. 'UDZHU

Non-Adjustable Bin in the Freezer* To remove: Push in plastic tab on either left or right side To replace: Slide bin into location until it locks into place. Basket Removal To remove, standard depth models only: 2SHQIUHH]HUGRRUWRWKHVWRSSRVLWLRQ

basket and moving basket rearward until the front of the basket can be rotated upward and out. /LIWLWRXWWRUHPRYH To remove, counter depth models only:

1. Open fresh food doors.

basket and rotate it upward. /LIWLWRXWWRUHPRYH To replace: Reverse step 1 through 4 to replace. *Select Models Only Baskets, Drawers, and Bins Plastic Tabs

  • Open the ice box door on inside of the left door.• Pull up and out on the ice bucket in the left hand door to remove it from the compartment .• To replace the ice bucket, set it on the guide brackets and push until the ice bucket seats properly.,IEXFNHWFDQQRWEHUHSODFHGURWDWHWKHLFHEXFNHWIRUNWXUQclockwise. Ice Maker (Available on Non Dispense models, also available as IM Kit for some models) 7KHUHLVDGGLWLRQDOLFHVWRUDJHLQWKHIUHH]HUFRPSDUWPHQWdrawer.2SHQWKHIUHH]HUGUDZHU• The ice bucket is located on the left side of the upper basket.• Pull the upper basket forward to remove the ice bucket.)UHH]HU ,FH Bucket Automatic Ice Maker A newly installed refrigerator may take 12 to 24 hours to begin making ice. Automatic Ice maker* The ice maker will produce seven cubes per cycle DSSUR[LPDWHO\±FXEHVLQDKRXUSHULRGGHSHQGLQJRQIUHH]HUFRPSDUWPHQWWHPSHUDWXUHURRPtemperature, number of door openings and other use conditions.7KHLFHPDNHUZLOOILOOZLWKZDWHUZKHQLWFRROVWR)&$QHZO\LQVWDOOHGUHIULJHUDWRUPD\WDNHWRhours to begin making ice cubes.,IWKHUHIULJHUDWRULVRSHUDWHGEHIRUHWKHZDWHUOLQHconnection is made to the unit or if the water supply to an operating refrigerator is turned off, make sure that the ice maker is turned off. Once the water has been connected to the refrigerator, the ice maker may be turned on. See the table below for details.<RXPD\KHDUDEX]]LQJVRXQGHDFKWLPHWKHLFHPDNHUfills with water.Throw away the first few batches of ice to allow the water line to clear.Be sure nothing interferes with the sweep of the feeler arm. When the bin fills to the level of the feeler arm, the ice maker will stop producing LFH,WLVQRUPDOIRUseveral cubes to be joined together.,ILFHLVQRWXVHGfrequently, old ice cubes will become cloudy, taste stale and shrink. NOTE: ,QKRPHVZLWKORZHUWKDQDYHUDJHZDWHUpressure, you may hear the ice maker cycle multiple times when making one batch of ice. WARNING 7RPLQLPL]HWKHULVNRISHUVRQDOLQMXU\avoid contact with the moving parts of the ejector mechanism, or with the heating element that releases WKHFXEHV'RQRWSODFHILQJHUVRUKDQGVRQWKHautomatic ice making mechanism while the refrigerator is plugged in.)HHOHU$UP ,FH maker24 49-60764 Care and Cleaning Cleaning the Outside The stainless steel panels, door handles and trim. 7KHVWDLQOHVVVWHHOGRRUVDQGGRRUKDQGOHVRQVRPHPRGHOVFDQEHFOHDQHGZLWKDFRPPHUFLDOO\DYDLODEOHstainless steel cleaner. Cleaners with oxalic acid such as %DU.HHSHUV)ULHQG6RIW&OHDQVHUZLOOUHPRYHVXUIDFHUXVWWDUQLVKDQGVPDOOEOHPLVKHV8VHRQO\DOLTXLGcleanser free of grit and rub in the direction of the brush OLQHVZLWKDGDPSVRIWVSRQJH'RQRWXVHDSSOLDQFHwax or polish on the stainless steel. Silver-accented plastic parts. Wash parts with soap or other mild detergents. Wipe clean with a sponge, damp cloth or paper towel.'RQRWXVHVFRXULQJSDGVSRZGHUHGFOHDQHUVEOHDFKRUcleaners containing bleach because these products can scratch and weaken the paint finish.Should spill tray need cleaning use lime remover. Cleaning the Inside To help prevent odors, leave an open box of baking VRGDLQWKHUHIULJHUDWRUDQGIUHH]HUFRPSDUWPHQWV Unplug the refrigerator before cleaning. ,IWKLVLVQRWSUDFWLFDOZULQJH[FHVVPRLVWXUHRXWRIsponge or cloth when cleaning around switches, lights or controls.8VHDQDSSOLDQFHZD[SROLVKRQWKHLQVLGHVXUIDFHbetween the doors.8VHZDUPZDWHUDQGEDNLQJVRGDVROXWLRQ²DERXWDWDEOHVSRRQPORIEDNLQJVRGDWRDTXDUWOLWHURIZDWHU7KLVERWKFOHDQVDQGQHXWUDOL]HVRGRUV5LQVHDQGwipe dry.To clean the inside metal panel*, open the outer door XVLQJWKH'RRULQ'RRU/DWFK&OHDQWKHSDQHOZLWKDPLOGGHWHUJHQWDQGWKHQZLSHGU\ZLWKDVRIWFORWK'RQRWuse any stainless steel cleaner on the panel as it may damage the surrounding plastic. CAUTION 'RQRWFOHDQJODVVVKHOYHVRUcoverswith warm water when they are cold. Glass shelves and covers may break if exposed to sudden temperature changes or impact such as bumping or dropping. Tempered glass is designed to shatter into many small pieces if it breaks. 'RQRWZDVKDQ\SODVWLFUHIULJHUDWRUSDUWVLQWKHdishwasher. Behind the Refrigerator Be careful when moving the refrigerator away from the wall. All types of floor coverings can be damaged, particularly cushioned coverings and those with embossed surfaces. Raise the leveling legs located at the bottom front of the refrigerator.Pull the refrigerator straight out and return it to position by pushing it straight in. Moving the refrigerator in a side direction may result in damage to the floor covering or refrigerator./RZHUWKHOHYHOLQJOHJVXQWLOWKH\WRXFKWKHIORRUWhen pushing the refrigerator back, make sure you don’t roll over the power cord or water supply line. Preparing for Vacation )RUORQJYDFDWLRQVRUDEVHQFHVUHPRYHIRRGDQGunplug the refrigerator. Clean the interior with a baking VRGDVROXWLRQRIRQHWDEOHVSRRQPORIEDNLQJVRGDWRRQHTXDUWOLWHURIZDWHU/HDYHWKHGRRUVRSHQ,IWKHWHPSHUDWXUHFDQGURSEHORZIUHH]LQJKDYHDqualified service technician drain the water supply system to prevent serious property damage due to flooding.1. Turn refrigerator off or unplug the refrigerator.2. Empty ice bucket3. Turn water supply offIf you cut the water supply off, turn off the ice maker.8SRQUHWXUQLQJIURPYDFDWLRQ1. Replace the water filter.2. Run 2 gallons of water through the cold water GLVSHQVHUDERXWPLQXWHVWRIOXVKWKHV\VWHP

*Select Models Only49-60764 25

CARE AND CLEANING / REPLACING THE LIGHTS

*Select Models Only Preparing to Move Secure all loose items such as shelves and drawers by taping them securely in place to prevent damage. When using a hand truck to move the refrigerator, do not rest the front or back of the refrigerator against the hand truck. This could damage the refrigerator. Handle only from the sides of the refrigerator. Be sure the refrigerator stays in an upright position during moving. Care and Cleaning Replacing the Lights Refrigerator Lights (LEDs) Appearance may vary by model. 7KHUHLV/('OLJKWLQJLQIUHVKIRRGFRPSDUWPHQWDQGRQ WKHERWWRPRIWKHIUHVKIRRGGRRUVWROLJKWWKHIUHH]HU compartment.*

$QDXWKRUL]HGWHFKQLFLDQZLOOQHHGWRUHSODFHWKH/('

light. ,IWKLVDVVHPEO\QHHGVWREHUHSODFHGFDOO*(

Read these instructions completely and carefully.WARNING Tip Over Hazard. %XLOWLQVW\OHPRGHOVPRGHO3<(&<(*<(3:(&:(DQG=:(DUHWRSKHDY\HVSHFLDOO\ZLWKDQ\doors open. These models must be secured with the anti-tip floor bracket to prevent tipping forward, which could result in death or serious injury. Read and follow the entire installation instructions for installing the anti-tip floor bracket packed with your refrigerator.

IMPORTANT — Observe all governing codes and ordinances. Save these instructions for local inspector’s use.• Note to Installer – Be sure to leave these instructions with the Consumer.• Note to Consumer –.HHSWKHVHLQVWUXFWLRQVIRUfuture reference.• Skill level – ,QVWDOODWLRQRIWKLVDSSOLDQFHUHTXLUHVbasic mechanical skills.

refrigerator. Ensure you have clearance to prevent damage to the refrigerator before safely moving it to the final location.

  • NOTE: Use a padded hand truck or moving straps to move this refrigerator. Place the refrigerator on the hand truck with a side against the truck. We strongly recommend that two people move and complete this installation. DIMENSIONS All measurements are given with leveling leg fully retracted. SD CD Overall Height to Top of Hinge Cover 69´ 69´ Height to Top of Cabinet 69´ 69´ Case Depth without Doors

Overall Exterior Depth Doors/Drawers with Handles

6WDQGDUG'HSWK6'0RGHOV2QO\&RXQWHU'HSWK&'0RGHOV2QO\ &DVH'HSWKZR'RRUV´6'´&'Height from floor to hinge cover top ´ $GGLWLRQDO'LPHQVLRQV ´6' ´&'

FullyAssembled36.375” 34.375” 34” 30.5” 29.625”Remove door parts in order until dimension is less than openingRemovingHandlesRemovingLH DoorCase w/Fz SlidesCase only(no hinges)If your model number starts with PFE, PFH, PFD, GFD, GFE, DFE (SD)FullyAssembled36.275” 33.75” 30.5” 29.625”Remove door parts in order until dimension is less than openingRemovingHandlesCase w/Fz SlidesCase only(no hinges)If your model number starts with GNE (SD)FullyAssembled31.375” 29.375” 25.875” 24.625”Remove door parts in order until dimension is less than openingRemovingHandlesRemovingLH DoorCase w/Fz SlidesCase only(no hinges)28.875”If your model number starts with DYE, GYE, PYE, PYD, PWE (CD) Installation Instructions28 49-60764 Installation Instructions

leading to the installation location must be at least

4´ZLGHLQRUGHUWROHDYHWKHGRRUVDQGKDQGOHV attached to the refrigerator while transporting it into

4´WKHUHIULJHUDWRUGRRUVDQGKDQGOHVFDQ easily be scratched and damaged. The top cap and doors can be removed to allow the refrigerator to be

/HDYHWDSHDQGDOOSDFNDJLQJRQGRRUVXQWLOWKH refrigerator is in the final location. Ŷ NOTE:8VHDSDGGHGKDQGWUXFNWRPRYHWKLV refrigerator. Place the refrigerator on the hand truck with a side against the truck. We strongly UHFRPPHQGWKDW7:23(23/(PRYHDQGFRPSOHWH this installation.

REMOVE THE FRESH FOOD

ONLY To Remove the Handle: Ŷ2SHQWKHRXWHUGRRUE\SUHVVLQJWKH'RRULQ 'RRUODWFK Ŷ/RRVHQWKHVHWVFUHZVDVVKRZQLQ6WHS To Install the Handle: Ŷ Align the lever with the opening on the outer door. Make sure the hook is pointed up. Ŷ,QVHUWWKHODWFKOHYHULQWRWKHRSHQLQJDQG align the handle with the mounting fasteners. Ŷ Once the handle is flush with the outer door, tighten the set screws. 'RQRWUHPRYHWDSHIURPGRRUXQWLOKDQGOHLV installed

Mounting )DVWHQHUV /HDYHILOP on until after installation INSTALLATION INSTRUCTIONS 'RRULQGRRU /DWFK /DWFK/HYHU with Hook facing up.49-60764 29

'LVFRQQHFWHOHFWULFDOFRQQHFWRUVFRPLQJIURPHDFKdoor located under the hinge covers. 5HPRYHWKH´KH[KHDGVFUHZWRGLVFRQQHFWWKHground wire from the hinge. 5HPRYHWKH´KH[KHDGVFUHZWRUHPRYHWKHstrain relief from the water line. 'LVFRQQHFWWKHZDWHUOLQHIURPWKHEDFNRIWKHXQLWby pressing down on the dark grey collar while pulling up on the water line. Pull water line through case conduit from the top to free the line for door removal. The water line is more than 4’ long and may need to be taped to 'RRUIRUDFFHVVLELOLW\ZKHQUHLQVWDOOLQJ8VLQJD´VRFNHWUDWFKHWGULYHUremove the screws securing the top hinge to the cabinet, then lift the hinge straight up to free the hinge pin from the location in the top of the door. CAUTION Lifting Hazard Single person lift could cause injury. Use assistance when handling, moving or lifting the doors.Note: when removing door, to prevent damage to door and electronics, carefully place the door in a proper location. Note: The lower door hinge pin and hinge are keyed and must be matched correctly for the door to self close properly. Please follow the directions carefully.

Securely tape the door shut with masking tape or have a second person support the door. Start with left-hand door first: Remove the hinge cover on top of the left refrigerator door by UHPRYLQJDOOKH[VFUHZVDQGSXOOLQJLWXS'RWKHsame for the right-hand door and the middle cover. Hinge Cover Ground screwStrain ReliefY or Straight Connector E 49-60764 REINSTALLING THE REFRIGERATOR DOORS Reverse steps 1 through 4 to reinstall refrigerator doors, follow details below for critical alignments.

Reinstall center hinge first and torque the screws to 65 in-lbs. :LWKWKH/+GRRU DWº to the front of the case, lower the refrigerator door onto the center hinge. Ensure that the door and hinge align correctly.

Rotate doors closed and make sure moveable center sealing portion of the door aligns with the VWULNHU,IWKHGRRUZLOOQRWVHOIFORVHDIWHU reinstalling, remove door, turn door upside down, FKHFNDOLJQPHQWPDUNDQGDUURZWKHUHLVDQ DOLJQPHQWPDUNRQWKHGRRUFORVXUHPHFKDQLVP,W corresponds to an alignment arrow on the plastic ring. Rotate door closure mechanism to align mark DQGDUURZUHLQVWDOOGRRU'RRULQ'RRUPRGHOVGR not have the same closure mechanism on the right hand door. You may notice a difference in closure. Securely tape the door shut with masking tape or have a second person support the door. Reinstall the top hinge and torque the screws to 65 in-lbs.

Be sure to reinstall the ground wire and strain relief to the top hinge.

Reinstall hinge cover. NOTE: Ensure wires are not pinched or under screw bosses before tightening screws.

DOORS (cont) Note: For proper installation later, please follow the next step carefully.

Remove the tape and keeping the door as VWUDLJKWDVSRVVLEOHRSHQWKHGRRUWRº then lift straight up to remove it.

REMOVE OPPOSITE DOOR

)ROORZWKHVDPHSURFHGXUHRQWKHRSSRVLWHGRRU There are no water lines on the opposite side. For Door in Door Models: Securely tape the inner and outer doors before installing or removing. º door alignment not required during installation or removal for these models.

3XOOWKHIUHH]HUGRRURSHQWRIXOOH[WHQVLRQRemove 3 attachment screws, located at the ERWWRPRQHDFKVLGHRIWKHIUHH]HUGRRUXVLQJ´KH[VRFNHWGULYHU CAUTION Lifting HazardFreezer door is heavy Use both hands to secure the door before lifting./LIWWKHIUHH]HUGRRUto disengage it from the slide mechanismThe door can safely rest on the bottom. 'RQRWUHVWWKHdoor on any other surfaces to avoid scratches.

BASKET SLIDES 7KHIUHH]HUEDVNHWVOLGHVFDQEHUHPRYHGWRJDLQDQRWKHU´FOHDUDQFHWKURXJKDGRRUZD\5HPRYHIUHH]HUGRRUDVVKRZQLQ6WHSRemove the upper and lower baskets as shown in Step 7.Remove the clip on the crossbar located along the right hand side of the rack and pinion gear assembly by sliding forward.Remove crossbar by sliding to the right, then pull out and to the left.5HPRYHWKHIRXU´KH[KHDGEROWVSHUVLGHand remove side supports.Reverse the steps to assemble. When installing the crossbar, always put the hole on the right hand side. Align the left and right gears with the timing marks on the gears when inserting the crossbar. Always insert the crossbar in the right hang gear first and then the left hand gear.,QVHWWKHFOLSLQWRWKHFURVVEDUKROHORFDWHGRQthe right hand side.

Pull the lower basket and slide mechanism to full extension using both hands.Remove the top IUHH]HUGUDZHUE\fully extending the drawer then lifting up and out.Remove the basket resting on the slides. Push the bottom basket slides back until the slide mechanism self retracts.

CAUTION Lifting Hazard Freezer door is heavy Use both hands to secure the door before lifting.Pull the lower basket slide mechanism to full extension with both hands./LIWWKHIUHH]HUGRRUDQGDOLJQWKHWDEVRQWKHdoor bracket sides with the square holes in slide mechanisms.Replace the attachment screws and torque the screws to 65 in-lb.)RUDGMXVWLQJIUHH]HUGRRUJDSVIROORZWKHLQVWUXFWLRQVRQSDJHRULQWKH2ZQHU¶VManual.5HSODFHIUHH]HUEDVNHWRQWRWKHVOLGHEUDFNHWVDQGPDNHVXUHWKHIUHH]HUGRRURSHUDWHVDQGcloses freely. Align and insert WDERQ)UHH]HU'RRU%UDFNHWZLWKVORWRQ)UHH]HUSlide Bracket.NOTE: Place one side in first and then align the other side.

E49-60764 33 INSTALLATION INSTRUCTIONS IMPORTANT! The 6 mounting screws (3 on each side) are NOT interchangeable with the center or top hinge screws. Drawer screws have flat washer heads, and other screws have lines/ribs on washer heads. $IWHULQVWDOODWLRQRIWKHIUHH]HUGRRUFKHFNIRUXQLIRUPJDSVWRSDQGERWWRPRIULJKWDQGOHIWKDQGVLGHZLWKWKH template provided.

attachment screws on both sides using a ´KH[VRFNHWGULYHU /RFDWHDQGORRVHQWKHFDPVFUHZXVLQJWKH T-27 screw driver.

REMOVE PACKAGING Remove all tape, foam and protective packing from shelves and drawers.

(cont.) /LIWWKHGRRURQWKHVLGHUHTXLULQJ adjustment, rotate the cam to required position. After adjustment tighten the 3 attachment screws using to 65 in-lb.

INSTALLATION INSTRUCTIONS MEASURE CABINET OPENING AVAILABLE VS. REFRIGERATOR WIDTH Measure width of cabinet opening where refrigerator will be placed, W.Be sure to account for any countertop overhang, baseboard thickness and any clearance desired. :LGWK:VKRXOGQRWEHOHVVWKDQ´7KHrefrigerator will be placed approximately in the middle of this opening.

FLOOR BRACKET Place the anti-tip floor bracket locator template LQFOXGHGLQVLGHWKHDQWLWLSNLWRQWRWKHIORRUup against the rear wall, within W, and in line with the desired location of the RH side of the UHIULJHUDWRUVHH)LJXUHPlace the anti-tip floor bracket onto the locator template with its RH floor holes lined up with the floor holes indicated on the template sheet, DSSUR[LPDWHO\ó´IURPWKHHGJHRIWKHVKHHWor the RH side of the refrigerator. Hold down in position and use the anti-tip floor bracket as a template for marking the holes based upon your configuration and type of construction as shown in Step 3. Mark the hole locations with a pencil, nail or awl.NOTE:,WLV5(48,5('WRXVHDWOHDVWVFUHZVWRPRXQWWKHIORRUEUDFNHWRQHRQHDFKVLGHRIWKHDQWLWLSIORRUEUDFNHW%RWKPXVWEHLQWRHLWKHUWKHZDOORUWKHIORRU)LJXUHLQGLFDWHVall the acceptable mounting configurations for VFUHZV,GHQWLI\WKHVFUHZKROHVRQWKHDQWLWLSfloor bracket for your configuration. AT-2

Baseboard Thickness or Countertop Overhang :KLFKHYHU,V/DUJHU3OXV$Q\'HVLUHGClearanceRear Wall)URQWRH Side 5()5,*(5$725)LJXUH± ,QVWDOODWLRQ2YHUYLHZBase Bracket on the Refrigerator2 Wall HolesRH Side of Refrigerator)ORRU±&RQFUHWH+ROHV)ORRU±:RRG+ROHVó´/RFDWRUTemplate Sheet)ORRU%UDFNHWWR,QVWDOORH HolesRear RH Corner of Cabinet Wall WARNING Tip Over Hazard. %XLOWLQVW\OHPRGHOVPRGHO3<(&<(*<(3:(&:(DQG=:(DUHWRSKHDY\HVSHFLDOO\ZLWKDQ\doors open. These models must be secured with the anti-tip floor bracket to prevent tipping forward, which could result in death or serious injury. Read and follow the entire installation instructions for installing the anti-tip floor bracket packed with your refrigerator.NOTE: ,I\RXGLGQRWUHFHLYHDQDQWLWLSEUDFNHWZLWK\RXUSXUFKDVHFDOOWRUHFHLYHRQHDWQRFRVW,Q&DQDGDFDOO)RULQVWDOODWLRQLQVWUXFWLRQVRIWKHEUDFNHWYLVLWZZZGEAppliances.com. ,Q&DQDGDZZZ*($SSOLDQFHVFD Installation Instructions INSTALLING THE REFRIGERATOR (Cont.) Anti-Tip Floor Bracket Installation (Models PYE, CYE, GYE, DYE, PWE, CWE, and ZWE only)36 49-60764 AT-2

'ULOOWKHUHFRPPHQGHGVL]HKROHVIRUWKH anchors into the concrete at the center of the holes marked in Step 2.

,QVWDOOWKHVOHHYHDQFKRUVLQWRWKHGULOOHGKROHV Place the anti-tip floor bracket as indicated in Step

2. Remove the locator template from the floor.

,QVWDOOWKHODJEROWVWKURXJKWKHDQWLWLSIORRU bracket and tighten appropriately.

center of each hole.

  • Mount the anti-tip floor bracket using the
  • Mount the anti-tip floor bracket by fastening the RUUHFRPPHQGHGKH[KHDGVFUHZV

THE ANTI-TIP FLOOR AND

BASE BRACKETS Before pushing the refrigerator into the opening, plug the power cord into the receptacle and FRQQHFWZDWHUOLQHLIHTXLSSHG&KHFNIRUOHDNV

/RFDWHWKHUHIULJHUDWRU¶V5+VLGHDQGPRYHEDFN

approximately in line with the RH side of the cabinet opening, W. This should position the anti-tip floor bracket to engage the anti-tip base bracket on the refrigerator. Gently roll the refrigerator back into the cabinet opening until it comes to a complete stop. Check to see if the refrigerator front lines up

ZLWKWKHFDELQHWIURQWIDFH,IQRWFDUHIXOO\URFN

the refrigerator forward and backward until engagement occurs and you notice that the refrigerator is fully pushed up against the rear wall. If Applicable:$GMXVWWKHUHDUDQGIURQWZKHHO height settings to fully engage the rear anti-tip brackets, while also aligning the refrigerator front with the cabinet front face.

away from the wall for any reason, make sure the anti-tip floor bracket is engaged when the refrigerator is pushed back against the rear wall. Rear RH Corner of the Refrigerator)ORRUWall Plate Stud )ORRUBracket2 Screws Must Enter Wood or Metal Stud Wall Installation Instructions INSTALLING THE REFRIGERATOR (Cont.) Anti-Tip Floor Bracket Installation (Models PYE, CYE, GYE, DYE, PWE, CWE, and ZWE only)

INSTALLATION INSTRUCTIONS49-60764 37

INSTALLATION INSTRUCTIONS CONNECTING THE REFRIGERATOR TO THE HOUSE WATER LINE A cold water supply is required for automatic LFHPDNHURSHUDWLRQ,IWKHUHLVQRWDFROGZDWHU supply, you will need to provide one. See

,QVWDOOLQJWKH:DWHU/LQHVHFWLRQ

  • Before making the connection to the refrigerator, be sure the refrigerator power cord is not plugged into the wall outlet. ,I\RXUUHIULJHUDWRUGRHVQRWKDYHDZDWHU filter, we recommend installing one if your water supply has sand or particles that could clog the screen of the refrigerator’s ZDWHUYDOYH,QVWDOOLWLQWKHZDWHUOLQHQHDU

DGGLWLRQDOWXEH:;;WRFRQQHFWWKH ILOWHU'RQRWFXWSODVWLFWXEHWRLQVWDOOILOWHU

  • Before connecting the water line to the house, purge the house line for at least 2 minutes. ,I\RXDUHXVLQJFRSSHUWXELQJSODFHD FRPSUHVVLRQQXWDQGIHUUXOHVOHHYHRQWRWKH end of the tubing coming from the house cold water supply.

tubing, the nuts are already assembled to the tubing. ,I\RXDUHXVLQJFRSSHUWXELQJLQVHUWWKHHQG of the tubing into the refrigerator connection, at the back of the refrigerator, as far as possible. While holding the tubing, tighten the fitting.

tubing, insert the molded end of the tubing into the refrigerator connection, at the back of the refrigerator, and tighten the compression nut until it is hand tight. Then tighten one additional turn with a wrench. Over tightening may cause leaks. )DVWHQWKHWXELQJLQWRWKHFODPSSURYLGHGWR hold it in position. You may need to pry open the clamp.

TURN ON THE WATER SUPPLY

See the grounding information attached to the power cord.

The leveling legs have 2 purposes: /HYHOLQJOHJVDGMXVWVRWKHUHIULJHUDWRULV firmly positioned on the floor and does not wobble. /HYHOLQJOHJVVHUYHDVDVWDELOL]LQJEUDNH to hold the refrigerator securely in position during operation and cleaning. The leveling legs also prevent the refrigerator from tipping. Turn the leveling legs clockwise to raise the refrigerator, counterclockwise to lower it. NOTICE: To avoid possible property damage, the leveling legs must be firmly touching the floor.

JHWWLQJWKHGRRUVSHUIHFWO\HYHQ,I\RXQHHG

help, review the previous section on leveling the refrigerator.

,I\RXRSHQWKHIUHH]HUGRRU\RXFDQVHH

the center hinge. ,QVHUW´$OOHQZUHQFKLQWRWKHVKDIWRIWKH center hinge. Adjust the height by turning clockwise or counterclockwise. When you turn counterclockwise, the door will move up.

When the left door is lower than the right door.When the left door is higher than the right door.Adjustment point RAISE Installation Instructions INSTALLING THE REFRIGERATOR (Cont.)

INSTALLATION INSTRUCTIONS49-60764 395HIULJHUDWRU$VVHPEO\,QVWUXFWLRQVVXJJHVWHGDVVHPEO\

To place bins into doors: Match your bin with the letter shown.Position the bin hooks over the bin locator and push forward until inserted fully.Bin locator each sideBin hookrear each sidePush bin down until locked into position.,FHPDNHULQIUHH]HUavailable on Non-'LVSHQVHPRGHOVDQGDYDLODEOHDV,0.LWIRUsome models.

To place rotating bin into door:

1. Slide bin base assembly onto the bracket on

2. Slide the bin onto the bin base

To place adjustable bins into door: Position the bins over the bin locators and push down until locked in position. Installation Instructions INSTALLING THE REFRIGERATOR (Cont.) Bin Bin base ,QVWDOOmetal base Bin Bin locatorsAdjustable bins Rotating bin INSTALLATION INSTRUCTIONS Models PFD, PYD, GFD49-60764 41 INSTALLATION INSTRUCTIONS 5HFRPPHQGHGFRSSHUZDWHUVXSSO\NLWVDUH:;; :;;RU:;;GHSHQGLQJRQWKHDPRXQWRI tubing you need. Approved plastic water supply lines are SmartConnect

Refrigerator Tubing :;;:;;DQG:;; When connecting your refrigerator to a GE Appliances Reverse Osmosis Water System, the only

5HYHUVH2VPRVLV52:DWHU)LOWUDWLRQ6\VWHP

refrigerator’s water filtration cartridge in conjunction with the RO water filter can result in hollow ice cubes. Some models do not come equipped with the filter

E\SDVVSOXJ7RREWDLQDIUHHE\SDVVSOXJFDOO

*(&$5(6,Q&DQDGDFDOO This water line installation is not warranted by the UHIULJHUDWRURULFHPDNHUPDQXIDFWXUHU)ROORZWKHVH

LQVWUXFWLRQVFDUHIXOO\WRPLQLPL]HWKHULVNRIH[SHQVLYH

water damage. :DWHUKDPPHUZDWHUEDQJLQJLQWKHSLSHVLQKRXVH plumbing can cause damage to refrigerator parts and lead to water leakage or flooding. Call a qualified plumber to correct water hammer before installing the water supply line to the refrigerator. To prevent burns and product damage, do not hook up the water line to the hot water line. ,IWKHUHIULJHUDWRULVRSHUDWHGEHIRUHWKHZDWHU connection is made to the ice maker, see Controls section on page 9 to turn ice maker off. 'RQRWLQVWDOOWKHLFHPDNHUWXELQJLQDUHDVZKHUH WHPSHUDWXUHVIDOOEHORZIUHH]LQJ :KHQXVLQJDQ\HOHFWULFDOGHYLFHVXFKDVDSRZHU GULOOGXULQJLQVWDOODWLRQEHVXUHWKHGHYLFHLVGRXEOH insulated or grounded in a manner to prevent the

KD]DUGRIHOHFWULFVKRFNRULVEDWWHU\SRZHUHG

All installations must be in accordance with local plumbing code requirements.

Refrigerator Tubing kit, ´RXWHUGLDPHWHUWRFRQQHFWWKHUHIULJHUDWRUWRWKH ZDWHUVXSSO\,IXVLQJFRSSHUEHVXUHERWKHQGVRI the tubing are cut square. To determine how much tubing you need: measure the distance from the water valve on the back of the refrigerator to the water supply pipe. Be sure there is sufficient extra tubing to allow the refrigerator to move out from the wall after installation. SmartConnect

in the following lengths: ¶P ±:;; ¶P ±:;; ¶P ±:;; Installation Instructions

INSTALLING THE WATER LINE42 49-60764

NOTE: The only GE Appliances approved plastic tubing is that supplied in SmartConnect

plastic water supply line because the line is under pressure at all times. Certain types of plastic will crack or rupture with age and cause water damage to your home.

$*($SSOLDQFHVZDWHUVXSSO\NLW FRQWDLQLQJ

WXELQJVKXWRIIYDOYHDQGILWWLQJVOLVWHGEHORZLV available at extra cost from your dealer or from

  • A cold water supply. The water pressure must be EHWZHHQDQGSVL±EDU
  • Power drill. ´RUDGMXVWDEOHZUHQFK
  • Straight and Phillips blade screwdriver. 7ZR´RXWHUGLDPHWHUFRPSUHVVLRQQXWV DQGIHUUXOHVVOHHYHV²WRFRQQHFWWKHFRSSHU tubing to the shutoff valve and the refrigerator water valve.

Refrigerator Tubing kit, the necessary fittings are preassembled to the tubing.

,I\RXUH[LVWLQJFRSSHUZDWHUOLQHKDVDIODUHGILWWLQJ

DWWKHHQG\RXZLOOQHHGDQDGDSWHUDYDLODEOH DWSOXPELQJVXSSO\VWRUHVWRFRQQHFWWKHZDWHU line to the refrigerator OR you can cut off the flared fitting with a tube cutter and then use a FRPSUHVVLRQILWWLQJ'RQRWFXWIRUPHGHQGIURP SmartConnect

  • Shutoff valve to connect to the cold water line. The shutoff valve should have a water inlet ZLWKDPLQLPXPLQVLGHGLDPHWHURI´DWWKH SRLQWRIFRQQHFWLRQWRWKH&2/':$7(5/,1( Saddle-type shutoff valves are included in many water supply kits. Before purchasing, make sure a saddle-type valve complies with your local plumbing codes.

SHUT OFF THE MAIN WATER

SUPPLY Turn on the nearest faucet long enough to clear the line of water. ,QVWDOOWKHVKXWRIIYDOYHRQWKHQHDUHVWIUHTXHQWO\ used drinking water line.

Choose a location for the valve that is easily DFFHVVLEOH,WLVEHVWWRFRQQHFWLQWRWKHVLGHRI a vertical water pipe. When it is necessary to FRQQHFWLQWRDKRUL]RQWDOZDWHUSLSHPDNHWKH connection to the top or side, rather than at the bottom, to avoid drawing off any sediment from the water pipe.

'ULOOD´KROHLQWKHZDWHUSLSHHYHQLIXVLQJ DVHOISLHUFLQJYDOYHXVLQJDVKDUSELW5HPRYH any burrs resulting from drilling the hole in the pipe. Take care not to allow water to drain into the drill.

)DLOXUHWRGULOOD´KROHPD\UHVXOWLQUHGXFHG

ice production or smaller cubes. Installation Instructions INSTALLING THE WATER LINE (Cont.) WHAT YOU WILL NEED (Cont.)

INSTALLATION INSTRUCTIONS49-60764 43

INSTALLATION INSTRUCTIONS 3ODFHWKHFRPSUHVVLRQQXWDQGIHUUXOHVOHHYH for copper tubing onto the end of the tubing and connect it to the shutoff valve. Make sure the tubing is fully inserted into the valve. Tighten the compression nut securely.

Refrigerator Tubing kit, insert the molded end of the tubing into the shutoff valve and tighten compression nut until it is hand tight, then tighten one additional turn with a wrench. Over tightening may cause leaks. NOTE: Commonwealth of Massachusetts Plumbing Codes 248CMR shall be adhered to. Saddle valves are illegal and use is not permitted in Massachusetts. Consult with your licensed plumber.

Turn the main water supply on and flush out the tubing until the water is clear. Shut the water off at the water valve after about RQHTXDUWOLWHURUPLQXWHVRIZDWHUKDVEHHQ flushed through the tubing.

Tubing )DVWHQWKHVKXWRIIYDOYHWRWKHFROGZDWHUSLSH with the pipe clamp. NOTE: Commonwealth of Massachusetts Plumbing Codes 248CMR shall be adhered to. Saddle valves are illegal and use is not permitted in Massachusetts. Consult with your licensed plumber.

Tighten the clamp screws until the sealing washer begins to swell.

Pipe Clamp Vertical Cold Water Pipe Saddle-Type Shutoff Valve Washer ,QOHW(QG Pipe Clamp Clamp Screw Route the tubing between the cold water line and the refrigerator. Route the tubing through a hole drilled in the wall RUIORRUEHKLQGWKHUHIULJHUDWRURUDGMDFHQWEDVH FDELQHWDVFORVHWRWKHZDOODVSRVVLEOH

To complete the installation of the refrigerator, go

EDFNWR6WHSLQ,QVWDOOLQJWKH5HIULJHUDWRU

Installation Instructions INSTALLING THE WATER LINE (Cont.)44 49-60764 Newer refrigerators sound different from older refrigerators. Modern refrigerators have more features and use newer technology. HUMMM... WHOOSH... Ŷ The new high efficiency compressor may run faster and longer than your old refrigerator and you may hear a high-pitched hum or pulsating sound while it is operating.Ŷ <RXPD\KHDUDZKRRVKLQJVRXQGZKHQWKHGRRUVFORVH7KLVLVGXHWRSUHVVXUHHTXDOL]LQJZLWKLQWKHrefrigerator.Ŷ $IWHUGLVSHQVLQJLFHDPRWRUZLOOFORVHWKHLFHFKXWHto keep warn room air from entering the ice bucket, PDLQWDLQLQJLFHDWDIUHH]LQJWHPSHUDWXUH The hum of the motor closing the ice chute is normal, shortly after dispensing ice.

You may hear the fans spinning at high speeds. This happens when the refrigerator is first plugged in, when the doors are opened frequently or when a large amount of food is added to the refrigerator RUIUHH]HUFRPSDUWPHQWV7KHIDQVDUHKHOSLQJWRmaintain the correct temperatures.

The fans change speeds in order to provide optimal cooling and energy savings. CLICKS, POPS, CRACKS and SNAPS Ŷ You may hear cracking or popping sounds when the refrigerator is first plugged in. This happens as the refrigerator cools to the correct temperature.Ŷ The compressor may cause a clicking or chirping VRXQGZKHQDWWHPSWLQJWRUHVWDUWWKLVFRXOGWDNHXSWRPLQXWHVŶ Expansion and contraction of cooling coils during and after defrost can cause a cracking or popping sound.Ŷ On models with an ice maker, after an ice making cycle, you may hear the ice cubes dropping into the ice bucket.Ŷ After dispensing ice, a motor will close the ice chute to keep warm room air from entering the ice bucket, PDLQWDLQLQJLFHDWDIUHH]LQJWHPSHUDWXUH WATER SOUNDS Ŷ The flow of refrigerant through the cooling coils may make a gurgling noise like boiling water.Ŷ Water dropping on the defrost heater can cause DVL]]OLQJSRSSLQJRUEX]]LQJVRXQGGXULQJWKHdefrost cycle.Ŷ A water dripping noise may occur during the defrost cycle as ice melts from the evaporator and flows into the drain pan.Ŷ Closing the door may cause a gurgling sound due to SUHVVXUHHTXDOL]DWLRQ Do you hear what I hear? These conditions are normal.

is lit 2YHU'XHOLJKWLVOLW Water filter leaking or needs replacing Water filter backwards Replace water filter, check for leak 5HPRYHILOWHUURWDWHDQGUHLQVWDOO 'LVSHQVHU2IILVOLW Control A, B & C Wrong filter installed Replace filter with proper filter 5HPRYHILOWHUURWDWHDQGUHLQVWDOO Not filtering )LOWHUE\SDVVLQVWDOOHG&RQWUROV%

,QVWDOOFRUUHFWZDWHUILOWHU 5HVHW)LOWHULVOLW Water filter leaking or needs replacing Replace water filter, or install filter bypass **

3UHVVDQGKROG5HVHW)LOWHUIRU

VHFRQGVWRUHVHW&RQWURO'RQO\ Water filter indicator light is not lit This is normal. This indicator will turn on to tell you that you need to replace the filter soon. See About the Water Filter for more information. +DQGOHLVORRVHKDQGOHKDVDJDS Handle needs adjusting See Attach Fresh Food Handle and

$WWDFKWKH)UHH]HU+DQGOHVHFWLRQVIRU

detailed instructions. Refrigerator beeping This is door alarm -Turn off or disable with door closed ,IGRRURSHQDQGDODUPLVVRXQGLQJ

\RXFDQRQO\VQRR]HWKHDODUP

Not cooling The cooling system is off See About Controls. :DWHUKDVSRRUWDVWHRGRU Water dispenser has not been used for a long time 'LVSHQVHZDWHUXQWLODOOZDWHULQ system is replenished. Water in glass is warm* Normal when refrigerator is first installed Wait 24 hours for the refrigerator to completely cool down. Water dispenser has not been used for a long time 'LVSHQVHZDWHUXQWLODOOZDWHULQ system is replenished Water system has drained Allow several hours for replenished supply to chill Water dispenser does not work* Water supply line turned off or not connected See Installing the Water Line :DWHUILOWHUFORJJHGRUILOWHUE\SDVV plug not installed Replace filter cartridge or remove filter and install bypass plug** Air may be trapped in the water system Press the dispenser arm for at least 5 minutes. :DWHULQUHVHUYRLULVIUR]HQEHFDXVH the controls are set too cold Set the refrigerator control to a warmer VHWWLQJDQGZDLWKRXUV,IWKHZDWHU does not dispense after 24 hours, call for service *Select Models Only

6RPHPRGHOVGRQRWFRPHHTXLSSHGZLWKWKHILOWHUE\SDVVSOXJ7RREWDLQDIUHHE\SDVVSOXJFDOO*(&$5(6,Q&DQDGDFDOO

Troubleshooting Tips... Before you call for service

Problem Possible Causes What to Do Water spurting from dispenser* Newly installed filter cartridge Run water from the dispenser for 5 PLQXWHVDERXWJDOORQV No water or ice cube production* Supply line or shutoff valve is clogged Call a plumber Water filter is clogged Replace filter cartridge or remove filter and install bypass plug** )LOWHUFDUWULGJHQRWSURSHUO\LQVWDOOHG Remove and reinstall filter cartridge, being certain that it locks in place. ,FHPDNHULVWXUQHGRII Check that the ice maker is turned on. See About the Automatic Ice Maker. Water is leaking from dispenser* Air may be present in the water line system, causing water to drip after being dispensed 'LVSHQVHZDWHUIRUDWOHDVWPLQXWHVWR remove air from system AUTO FILLXQGHUILOOQRILOO Not all containers work with AUTOFILL Try different container Error message See page 14 Clean sensor. See page 14. AUTO FILL overfills* Not all containers work with AUTO FILL Try different container )UHH]HUFRROLQJIUHVKIRRGQRWFRRO- ing Normal, when refrigerator first plugged in or after extended power outage Wait 24 hours for temperature in both compartments to reach selected temperatures. ,FHGLVSHQVHURSHQVDIWHUFORVLQJ IUHH]HUGUDZHU Normal The ice dispenser door may open after FORVLQJIUHH]HUGRRUWRDOORZDFFHVV /RZEUHZLQJIORZUDWH There may have been a dent at the ERWWRPRI.&XSFDXVLQJWKHSLQ to pierce the filter allowing coffee grounds clogging the bottom pin $YRLGXVLQJGDPDJHGGHQWHG.FXSV and clean the lower needle before next brew /RZEUHZLQJIORZUDWHZDWHUGULSV from inner door Top needle of the brewer clogged 8QFORJWKHWRSQHHGOHKROHVXVLQJD paper clip and rinse brewer. Rinse brewer after every use. Brewer is not detected or hot water leaking from top of the brewer ,QFRUUHFWDVVHPEO\RIEUHZHULQWKH bracket

0DNHVXUHWKH.HXULJ/RJRLVLQWKH

front. Push brewer all the way in the brackets Coffee dispensed with splash or bubble bursting Blocked vent hole in the brewer Make sure the vent hole at the bottom of the brewer is clear from food or any other contamination Troubleshooting Tips... Before you call for service

Problem Possible Causes What to Do Beverage quality not as expected You may be using non-standard or RXWGDWHG.&XSV 5HFRPPHQGXVLQJRIILFLDO.HXULJ .FXSVWKDWDUHQRWSDVWH[SLUDWLRQDQG have not been damaged /LTXLGGULSVIURPWKHEUHZHUDIWHU brewer cycle is completed and the brewer is removed from the bracket ,WLVSRVVLEOHIRUOLTXLGVWREH retained by the brewer and drip when it is removed 8VHDFORWKRUFRQWDLQHUWRFDSWXUHWKH drips when brewer is removed

'HOD\ZKHQXVLQJ.HXULJ.FXS3RG

dispenser To ensure a quality beverage is delivered, a short delay is required to ensure the refrigerator is operating correctly Ensuring consistent, quality operation requires the refrigerator to delay dispense for a short period of time After brewing, my powdered beverage is not fully cleared from the used pod 'HSHQGLQJRQVL]HVHOHFWHGWKH powder may not dissolve fully. Some powdered beverages develop into ‘clumps’ when left sitting for some time Shake the powdered pods before brewing to break up these clumps and DOORZEHWWHUFOHDULQJ)RUSRZGHUHG beverage with no filter, use the Cocoa cycle selection Brewer lid is difficult to close .FXSLVQRWIXOO\VHDWHG 3UHVV.FXSDOOWKHZD\GRZQLQWRWKH EUHZHUSULRUWRFORVLQJWKHOLG/RZHU QHHGOHPXVWSXQFWXUH.FXSEIRUH closing the brewer lid Brewer leaks during the brew cycle Trouble in closing brewer lid or GDPDJHG.FXS

not been damaged and have a good seal between the top cover and plastic bottom Troubleshooting Tips... Before you call for service48 49-60764

TROUBLESHOOTING TIPS/TRUTH OR MYTH

Truth or Myth? Answer ExplanationThe refrigerator water filter may require re-placement prior to six months758( The water filter indicator will indicate the need to replace the water ILOWHUHYHU\VL[PRQWKVRUJDOORQVRIZDWHUGLVSHQVHGVHOHFWPRGHOVRQO\:DWHUTXDOLW\YDULHVIURPFLW\WRFLW\,IZDWHUIORZIURPthe dispenser slows, or ice production decreases, the water filter should be replaced, even though the filter indicator may not indicate the need for replacement. The automatic ice maker in my refrigerator will produce ice when the refrigerator is plugged into a power receptacle.MYTH The refrigerator must be connected to water, and the ice maker must be turned on. Make sure the ice maker is turned on, only after the water line is connected and water is turned on. The ice maker can be turned onoff from the controls and ensure the ice maker is on, as indicated on the refrigerator control panel. See About the Automatic Ice Maker.After the refrigerator has been plugged in and FRQQHFWHGWRZDWHU,ZLOOLPPHGLDWHO\KDYHunlimited chilled water available from the water dispenser.MYTH The water dispenser tank located inside the refrigerator stores water for dispensing. The water in this tank requires 24 hours to chill after installation. High usage conditions will not allow time for the water to chill.After water dispenses, a few drops of water are normal.758( A few drops of water may fall from the dispenser, after the dispenser SDGGOHKDVEHHQUHOHDVHG7RPLQLPL]HWKHGURSVUHPRYHWKHJODVVslowly from the dispenser.,ZLOOQHYHUVHHIURVWLQVLGHWKHIUHH]HUFRP-partment.MYTH )URVWLQVLGHWKHIUHH]HUW\SLFDOO\LQGLFDWHVWKDWWKHGRRULVQRWSURSHUO\VHDOHGRUKDVEHHQOHIWRSHQ,IIURVWLVIRXQGFOHDUWKHfrost using a plastic spatula and towel, then check to ensure that no IRRGSDFNDJHVRUFRQWDLQHUVDUHSUHYHQWLQJWKHIUHH]HUGRRUIURPclosing. Check the refrigerator control panel to ensure the door alarm is on.When the refrigerator is installed, or after re-SODFLQJWKHZDWHUILOWHU,PXVWGLVSHQVHZDWHUfor five minutes. 758( A newly installed refrigerator or water filter contains air in the water lines. Press the dispenser paddle and dispense cold water for at least 5 minutes to remove air from the water line, and flush the filter.To fill the ice bucket to the maximum capac-LW\,VKRXOGGLVSHQVHDQGKRXUVDIWHUinstallation.758( 'LVSHQVLQJFXEHVKRXUVDQGKRXUVDIWHULQVWDOODWLRQallows ice to disperse within the ice bucket, which in turns calls on the ice maker to produce additional ice. Normal ice production = FXEHVLQKRXUV,FDQXVHWKHZDWHUILOWHUE\SDVVSOXJWRGHWHU-mine if the filter requires replacement.758( 'HFUHDVHLQIORZIURPWKHZDWHUGLVSHQVHURUGHFUHDVHGLFHSURGXFWLRQPD\LQGLFDWHWKHQHHGWRUHSODFHWKHZDWHUILOWHU,QVWDOOWKHZDWHUILOWHUE\SDVVSOXJSURYLGHGZLWKWKHUHIULJHUDWRURQVRPHPRGHOVDQGFKHFNIORZIURPWKHGLVSHQVHU,IZDWHUIORZUHWXUQVWRnormal with the bypass plug in place, replace the water filter.The top of the refrigerator doors will always be aligned.MYTH Several things can affect the fresh food door alignment, including WKHIORRUWKHUHIULJHUDWRULVLQVWDOOHGRQDQGORDGLQJRIGRRUV,IWKHWRSRIWKHIUHVKIRRGGRRUVDUHQRWDOLJQHGXVHD´DOOHQZUHQFKWRDGMXVWWKHULJKWOHIWKDQGGRRU7KHDGMXVWPHQWVFUHZLVORFDWHGRQWKHERWWRPULJKWRUOHIWKDQGVLGHRIWKHGRRURSHQWKHIUHH]HUdoor to access the screw. Refrigerator door handles can be easily tight-ened.758( ,IGRRUKDQGOHVDUHORRVHRUKDYHDJDSWKHKDQGOHFDQEHDGMXVWHGXVLQJD´DOOHQZUHQFKRQVHWVFUHZVORFDWHGRQWKHHQGVRIWKHhandles.There may be odor and taste problems with your ice.758( After starting the ice maker, throw away 24 hours of ice production to avoid odor and taste problems.,FDQPDNHILQHDGMXVWPHQWVWRWKHIUHVKIRRGdoors to align them.758( ,IWKHIUHVKIRRGGRRUVDUHQRWDOLJQHGXVHD´$OOHQZUHQFKWRadjust the right hand door. The adjustment screw is located on the ERWWRPRIWKHULJKWOHIWKDQGGRRU2SHQWKHIUHH]HUGRRUWRDFFHVV Truth or Myth Truth or Myth SERVICE Before you call for service, review the detailed troubleshooting tips in the Owner’s manual. ,IQHHGHGVHUYLFHFDQEHVFKHGXOHGE\YLVLWLQJXVRQOLQHGEAppliances.com or calling *(&$5(6,Q&DQDGDYLVLWGEAppliances.caRUFDOO49-60764 49

TROUBLESHOOTING TIPS/TRUTH OR MYTH

Truth or Myth? Answer Explanation'RRUKDQGOHVVKRXOGDOZD\VEHUHPRYHGIRUinstallation.MYTH ,IWKHGRRUVPXVWEHUHPRYHGGRQRWUHPRYHWKHKDQGOHVRULIWKHrefrigerator will fit easily through the passage way opening. Adjust KDQGOHVWKDWDUHORRVHRUKDYHDJDSE\DGMXVWLQJ´VHWVFUHZVon either end of handles.'RRUUHPRYDOLVDOZD\VUHTXLUHGIRUinstallation.MYTH &KHFNFKDUWRQUHYHUVHVLGHRIWKLVLQVWUXFWLRQ'RRUVVKRXOGRQO\EHremoved when necessary to prevent damage from passage way or access to final location. Refrigerator doors that won’t close after installation, can be adjusted to close properly.758( 'RRUPHFKDQLVPZRUNVEHVWLILQVWDOOHGDW,ILQVWDOOHGDWUHPRYHWKHGRRUIURPWKHPLGKLQJHDQGVZLQJWKHGRRUEHIRUHreinstalling. See Reinstalling the Refrigerator Doors. There is an adjustment to rear wheels. MYTH )URQWOHYHOLQJOHJVDUHDGMXVWDEOHDQGVKRXOGEHXVHGWREDODQFHWKH UHIULJHUDWRU/HYHOLQJOHJVDUHXVHGWRPDNHLQLWLDOIUHVKIRRGGRRUadjustment.Check for leaks after all water connections are made.758( While purging the air from the water system, check all water line connections for leaks. Check the connection to the household water supply at back of refrigerator, and door water line connect.Any packaging residue can be cleaned off the refrigerator using any cleaner.MYTH 'RQRWXVHZD[SROLVKEOHDFKRURWKHUSURGXFWVFRQWDLQLQJFKORULQHon Stainless Steel panels, door handles and trim. Check this LQVWUXFWLRQXQGHU³&OHDQLQJWKH2XWVLGH´IRUIXOOGHWDLOV

6RPHPRGHOVGRQRWFRPHHTXLSSHGZLWKWKHILOWHUE\SDVVSOXJ7RREWDLQDIUHHE\SDVVSOXJFDOO*(&$5(6,Q&DQDGDFDOO

Truth or Myth Truth or Myth SERVICE Before you call for service, review the detailed troubleshooting tips in the Owner’s manual. ,IQHHGHGVHUYLFHFDQEHVFKHGXOHGE\YLVLWLQJXVRQOLQHGEAppliances.com or calling *(&$5(6,Q&DQDGDYLVLWGEAppliances.caRUFDOO 49-60764 Ŷ Service trips to your home to teach you how to use the product. Ŷ,PSURSHULQVWDOODWLRQGHOLYHU\RUPDLQWHQDQFH Ŷ)DLOXUHRIWKHSURGXFWLILWLVDEXVHGPLVXVHGRU used for other than the intended purpose or used commercially. Ŷ/RVVRIIRRGGXHWRVSRLODJH Ŷ5HSODFHPHQWRIKRXVHIXVHVRUUHVHWWLQJRIFLUFXLW breakers. Ŷ'DPDJHWRILQLVKVXFKDVVXUIDFHUXVWWDUQLVKRU small blemishes not reported within 48 hours of delivery. Ŷ5HSODFHPHQWRIWKHZDWHUILOWHUFDUWULGJHLI included, due to water pressure that is outside the specified operating range or due to excessive sediment in the water supply. Ŷ5HSODFHPHQWRIWKHOLJKWEXOEVLILQFOXGHGRU water filter cartridge, if included, other than as noted above. Ŷ'DPDJHWRWKHSURGXFWFDXVHGE\DFFLGHQWILUH floods or acts of God. Ŷ,QFLGHQWDORUFRQVHTXHQWLDOGDPDJHFDXVHGE\ possible defects with this appliance. Ŷ3URGXFWQRWDFFHVVLEOHWRSURYLGHUHTXLUHGVHUYLFH

Ŷ'DPDJHFDXVHGE\DQRQ*($SSOLDQFHV%UDQG

water filter. What GE Appliances Will Not Cover: For the Period of: GE Appliances Will Replace One Year )URPWKHGDWHRIWKH original purchase Any part of the refrigerator which fails due to a defect in materials or workmanship. 'XULQJWKHlimited one-year warranty, GE Appliances will also provide, free of charge, all labor and related service to replace the defective part. Thirty Days :DWHUILOWHULILQFOXGHG )URPWKHRULJLQDOSXUFKDVH date of the refrigerator Any part of the water filter cartridge which fails due to a defect in materials or ZRUNPDQVKLS'XULQJWKLV limited thirty-day warranty, GE Appliances will also provide, free of charge, a replacement water filter cartridge.

GE PROFILE ™ MODELS ONLY

Five Years )URPWKHGDWHRIWKH purchase Any partRIWKHVHDOHGUHIULJHUDWLQJV\VWHPWKHFRPSUHVVRUFRQGHQVHUHYDSRUDWRU DQDOOFRQQHFWLQJWXELQJZKLFKIDLOVGXHWRDGHIHFWLQPDWHULDOVRUZRUNPDQVKLS 'XULQJWKLVOimited five-year sealed refrigerating system warranty, GE Appliances will also provide, free of charge, all labor and related service to replace the defective part in the sealed refrigerating system. GEAppliances.com For US Customers, DOOZDUUDQW\VHUYLFHLVSURYLGHGE\RXU)DFWRU\6HUYLFH&HQWHUVRUDQDXWKRUL]HG&XVWRPHU&DUH

technician. To schedule service online, visit us at www.geappliances.comRUFDOO*($SSOLDQFHVDW*(&$5(6

<RXUVROHDQGH[FOXVLYHUHPHG\LVSURGXFWUHSDLUDVSURYLGHGLQWKLV/LPLWHG:DUUDQW\$Q\LPSOLHGZDUUDQWLHV including the implied warranties of merchantability or fitness for a particular purpose, are limited to one year or the shortest period allowed by law. For US Customers: This warranty is extended to the original purchaser and any succeeding owner for products

SXUFKDVHGIRUKRPHXVHZLWKLQWKH86$,IWKHSURGXFWLVORFDWHGLQDQDUHDZKHUHVHUYLFHE\D*($SSOLDQFHV$XWKRUL]HG

Servicer is not available, you may be responsible for a trip charge or you may be required to bring the product to an $XWKRUL]HG*($SSOLDQFHV6HUYLFHORFDWLRQIRUVHUYLFH,Q$ODVNDWKHZDUUDQW\H[FOXGHVWKHFRVWRIVKLSSLQJRUVHUYLFH calls to your home. Some states do not allow the exclusion or limitation of incidental or consequential damages. This warranty gives you specific legal rights, and you may also have other rights which vary from state to state. To know what your legal rights are, consult your local or state consumer affairs office or your state’s Attorney General. Warrantor: GE Appliances, a Haier company For Customers in Canada: This warranty is extended to the original purchaser and any succeeding owner for

SURGXFWVSXUFKDVHGLQ&DQDGDIRUKRPHXVHZLWKLQ&DQDGD,QKRPHZDUUDQWVHUYLFHZLOOEHSURYLGHGLQDUHDVZKHUH

it is available and deemed reasonable by Mabe to provide. Warrantor Canada: MC Commercial, Burlington, Ontario, L7R 5B6 Servicing your refrigerator may require the use of the onboard data port for diagnostics. This gives a GE Appliances Factory Service technician the ability to quickly diagnose any issues with your appliance and helps GE Appliances improve its products by providing GE Appliances with information on your appliance. If you do not want your appliance data to be sent to GE Appliances, please advise your technician NOT to submit the data to GE Appliances at the time of service. Staple your receipt here. Proof of the original purchase date is needed to obtain service under the warranty. WARRANTY49-60764 51 RPWFE Water Filter Cartridge Limited Warranty. Contact us at www.geapplianceparts.com, or call 800.GE.CARES. This warranty is extended to the original purchaser and any succeeding owner for products purchased for home use within the U.S.A. In Alaska, the warranty excludes the cost of shipping or service calls to your home. Some states do not allow the exclusion or limitation of incidental or consequential damages. This warranty gives you specific legal rights, and you may also have other rights which vary from state to state. To know what your legal rights are, consult your local or state consumer affairs office or your state’s Attorney General. For Purchases Made In Iowa: This form must be signed and dated by the buyer and seller prior to the consummation of this sale. This form should be retained on file by the seller for a minimum of two years. Buyer: Name AddressCity State ZipSignature Date Seller: Name AddressCity State ZipSignature Date For The Period Of: We Will Replace, At No Charge To You: Thirty Days From the date of the original purchase Any part of the water filter cartridge which fails due to a defect in materials or workmanship during this limited thirty-day warranty.* What is Not Covered:

  • Service trips to your home to teach you how to use the product.
  • Improper installation.
  • Failure of the product if it is abused, misused, used for other than the intended purpose or used commercially.
  • Replacement of house fuses or resetting of circuit breakers.
  • Replacement of the water filter cartridge due to water pressure that is outside the specified operating range or due to excessive sediment in the water supply.
  • Damage to the product caused by accident, fire, floods or acts of God.
  • Incidental or consequential damage caused by possible defects with this appliance. Staple your receipt here. Proof of the original purchase date is needed to obtain service under the warranty.Appliance Service800-GE-CARES Appliances
  • If your GE part fails because of a manufacturing defect within thirty days from the date of original purchase for use, we will give you a new or, at our option, a rebuilt part without charge. Return the defective part to the parts supplier from whom it was purchased together with a copy of the “proof of purchase” for the part. If the part is defective and shows no signs of abuse, it will be exchanged. The warranty does not cover the failure of parts which are damaged while in your possession, are abused, or have been installed improperly. It does not cover the cost of returning the part to the supplier from whom it was purchased nor does it cover the cost of labor to remove or install it to diagnose the fault. It does not cover parts used in products in commercial use except in the case of air conditioning equipment. In no event shall GE be liable for consequential damages. Warrantor: General Electric Company EXCLUSION OF IMPLIED WARRANTIES: Your sole and exclusive remedy is part exchange as provided in this Limited Warranty. Any implied warranties, including the implied warranties of merchantability or fitness for a particular purpose, are limited to six months or the shortest period allowed by law.52 49-60764 Performance Data Sheet Model: GE RPWFE Use Replacement Cartridge RPWFE. The concentration of the indicated substances in water entering the system was reduced to a concentration less than or equal to the permissible limit for water leaving the system as specified in NSF/ANSI Standard 42 and Standard 53. System tested and certified by NSF International against NSF/ANSI Standard 42 and Standard 53 for the reduction of substances listed below. The following pharmaceutical reduction claims have not been certified by NSF International. Claims tested and verified by independent laboratory: Substance Reduction Average Influent NSF specified Challenge Concentration Avg % Reduction Average Product Water Concentration Max Permissible Product Water Concentration NSF Test Report Atenolol 1088 ng/L N/A 99.5% 5.0 ng/L N/A J-00103221 Fluoxetine 845 ng/L N/A 99.4% 5.0 ng/L N/A J-00103221 Ibuprofen 898 ng/L N/A 98.8% 9.9 ng/L N/A J-00103726 Progesterone 945 ng/L N/A 99.4% 5.5 ng/L N/A J-00103727 Trimethoprim 403 ng/L N/A 99.5% 2.0 ng/L N/A J-00103221 It is essential that the manufacturer’s recommended installation, maintenance and filter replacement requirements be carried out for the product to perform as advertised. See Installation Manual for Warranty information. Application Guidelines/Water Supply Parameters Service Flow 0.5 gpm (1.89 lpm) Water Supply Potable Water Water Pressure 25-120 psi (172– 827 kPa) Water Temperature 33º F - 100º F (0.6º C - 38º C) Note: While the testing was performed under standard laboratory conditions, actual performance may vary. Replacement Cartridge: RPWFE. For estimated costs of replacement elements please call 1-800-626-2002 or visit our website at www.geapplianceparts.com. WARNING To reduce the risk associated with ingestion of contaminants:
  • Do not use with water that is microbiologically unsafe or of unknown quality without adequate disinfection before and after the system. Systems certified for cyst reduction may be used on disinfected water that may contain filterable cysts. EPA Establishment Number 070595-MEX-001. NOTICE To reduce the risk of water leakage or flooding, and to ensure optimal filter performance:
  • Read and follow use instructions before installation and use of this system.
  • Installation and use MUST comply with all state and local plumbing codes.
  • Do not install if water pressure exceeds 120 psi (827 kPa). If your water pressure exceeds 80 psi, you must install a pressure-limiting valve. Contact a plumbing professional if you are uncertain how to check your water pressure.
  • Do not install where water hammer conditions may occur. If water hammer conditions exist you must install a water hammer arrester. Contact a plumbing professional if you are uncertain how to check for this condition.
  • Do not install on hot water supply lines. The maximum operating water temperature of this filter system is 100º F (38º C).
  • Protect filter from freezing. Drain filter when temperatures drop below 33ºF (0.6ºC).

a noticeable reduction in water flow rate.

lead to reduced filter performance and cracks in the filter housing, causing water leakage or flooding. Capacity 170 Gallons (643.5 Liters). Contaminant Reduction Determined by NSF testing. Substance Tested for Reduction Average Influent NSF specified Challenge Concentration Avg % Reduction Average Product Water Concentration Max Permissible Product Water Concentration NSF Reduction Requirements NSF Test Report Chlorine Taste and Odor 2.0 mg/L 2.0 mg/L ± 10% 97.4% 0.05 mg/L N/A ≥50% J-00102044 Nominal Particulate Class I, , ≥0.5 to < 1.0 μm 7,633,333 pts/mL At least 10,000 particles/mL 99.0% 71,850 pts/ml N/A ≥85% J-00106249 Asbestos 109 MFL

prompt service under the terms of your warranty, should the need arise. You may also mail in the pre-printed registration card included in the packing material. ,QWKH86GEAppliances.com/register ,Q&DQDGDProdsupport.mabe.ca/crm/Products/ProductRegistration.aspx Schedule Service Expert GE Appliances repair service is only one step away from your door. Get on-line and schedule your service at your FRQYHQLHQFHDQ\GD\RIWKH\HDU,QWKH86GEAppliances.com/ge/service-and-support/service.htm RUFDOOGXULQJQRUPDOEXVLQHVVKRXUV ,Q&DQDGDGEAppliances.ca/en/support/service-requestRUFDOO Extended Warranties Purchase a GE Appliances extended warranty and learn about special discounts that are available while your warranty is still LQHIIHFW<RXFDQSXUFKDVHLWRQOLQHDQ\WLPH*($SSOLDQFHV6HUYLFHVZLOOVWLOOEHWKHUHDIWHU\RXUZDUUDQW\H[SLUHV,QWKH86 GEAppliances.com/ge/service-and-support/shop-for-extended-service-plans.htm RUFDOOGXULQJQRUPDOEXVLQHVVKRXUV ,Q&DQDGDGEAppliances.ca/en/support/purchase-extended-warrantyRUFDOO Parts and Accessories ,QGLYLGXDOVTXDOLILHGWRVHUYLFHWKHLURZQDSSOLDQFHVFDQKDYHSDUWVRUDFFHVVRULHVVHQWGLUHFWO\WRWKHLUKRPHV

9,6$0DVWHU&DUGDQG'LVFRYHUFDUGVDUHDFFHSWHG2UGHURQOLQHWRGD\KRXUVHYHU\GD\

,QWKH86GEApplianceparts.com or by phone at 877.959.8688 during normal business hours. Instructions contained in this manual cover procedures to be performed by any user. Other servicing generally should be referred to qualified service personnel. Caution must be exercised, since improper servicing may cause unsafe operation. Customers in Canada should consult the yellow pages for the nearest Mabe service center, visit our website at GEAppliances. ca/en/products/parts-filters-accessoriesRUFDOO Contact Us

DYE, CYE, PWE, CWE, ZWE

GABINETE DISPONIBLE VS. EL

  • For this special case, locate the 2 wall holes

LGHQWLILHGLQ)LJ'ULOODQDQJOHG´PPSLORW

hole (approx. as shown in Fig. 3) in the center of each hole.

Ŷ 5HHPSOD]RGHOFDUWXFKRGHOILOWURGHDJXDVLVHLQFOX\H